SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW011487-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW011487-PA
Domain Number 1 Region: 217-367
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.24e-24
Family Laminin G-like module 0.0084
Further Details:      
 
Weak hits

Sequence:  ISCW011487-PA
Domain Number - Region: 71-237
Classification Level Classification E-value
Superfamily Tropomyosin 0.00373
Family Tropomyosin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW011487-PA
Sequence length 372
Comment conserved hypothetical protein|DS878752:36602:44837:-1|gene:ISCW011487
Sequence
MNPPKKVLTVKENAEIIWACIEKGTFLASPGAYVDFDSDGVIENADNSKERSLQLKDEAV
QLEERVELEMKGRVTEAQDRLAAIELHNKMNAKDLADVNKDLDNLQTGEVQQALRKSVAE
AQAAATRVEEASSRVQDILERLPGSNTHAQEVSSDNLGYKQAIVAASSYIDRALSPDQDL
GRQANRLVQRHKAMRATADDVRARIEELRRKVALARDEANRVKVGMEFDGQQWLRLKNPE
NLQEAATYTRLSLYLKTGEPEGTVAYLGNGRGDDFMALLLKGGNPVLVINLGDGTEEIRH
DRYVADNQWHQIIIDRTGKTVNLEVRTEGEPESIKTKYLQGTQSVFNLDQSSSKFYLGGL
PPDEQVWRHSLA
Download sequence
Identical sequences B7Q7X6
XP_002412233.1.51680 ISCW011487-PA 6945.ISCW011487-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]