SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW011587-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW011587-PA
Domain Number 1 Region: 521-702
Classification Level Classification E-value
Superfamily Fibronectin type III 1.35e-30
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 2 Region: 95-182
Classification Level Classification E-value
Superfamily Immunoglobulin 9.28e-23
Family I set domains 0.0074
Further Details:      
 
Domain Number 3 Region: 286-380
Classification Level Classification E-value
Superfamily Immunoglobulin 4.43e-22
Family I set domains 0.011
Further Details:      
 
Domain Number 4 Region: 5-97
Classification Level Classification E-value
Superfamily Immunoglobulin 6.37e-22
Family I set domains 0.021
Further Details:      
 
Domain Number 5 Region: 393-495
Classification Level Classification E-value
Superfamily Fibronectin type III 2.36e-20
Family Fibronectin type III 0.00017
Further Details:      
 
Domain Number 6 Region: 187-280
Classification Level Classification E-value
Superfamily Immunoglobulin 2.66e-19
Family I set domains 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW011587-PA
Sequence length 703
Comment conserved hypothetical protein|DS854743:302087:318271:1|gene:ISCW011587
Sequence
LRDEFRATPKSSRVAVGDSATLECIAPRGHPEPSVTWFKDGAQVATGTGRIRLLGHGSLL
IADVRHADQGRYVCRAANLLGTRETPAATLSVHTKPYFVRVPEDVTTLADETVEFQCKVN
GDPKPTVTWRRQDGKMPVGRASIQENKNLRIQNVSPMDEGTYICESENFVGSVSASASLT
VHCESRPSFRLTPEDQKVGLNGVAKFDCFATGNPQPSVFWTREGDQVLMFPGKSHGRFSV
TNEGTLVISSVRKEDRGYYTCSALSVVGSSMAKGHLEVTAMADLPPPVIRLGPANQTLPI
NTAAIMPCEATGKPTPTVRWQYNAVPLQTDTRPRFVILQSGTLRINGLQILDSGMYTCTA
SSESGETSWTASLTVESPHNPNVNFHRSPDPSTFPGPPSKPVVVNISETSITLTWRRSEK
VGESSLKGYTIEYYSSDLQSGWVSGAHRVLSETYTIQPLRPDSRYIFIIRAENSHGLGPP
SPASDTIRTLGLAPHFLPEYNLDEARAKLTSCMVTLMDMRAASSTAVKLTWRIQGDKDYV
EGFYIRFRDVSEGLQRYNMVTVLNGGASSYILNDLRPYAKYEFFLVPFYKSVEGPPSNSR
SVQTLEDVPTAAPEDVRAHVLNVTTATIFWSPPPPQHCNGKLKGYNVYLTGNLSEPFLNK
STNSTTNSLLVTNLKAGSSYKVCIVAHTSVGSGPLSSPVLFRM
Download sequence
Identical sequences B7Q4C6
XP_002411516.1.51680 6945.ISCW011587-PA ISCW011587-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]