SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW011695-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW011695-PA
Domain Number 1 Region: 87-234,335-382
Classification Level Classification E-value
Superfamily Fibronectin type III 1.1e-34
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 2 Region: 3-80
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000184
Family Fibronectin type III 0.0024
Further Details:      
 
Domain Number 3 Region: 414-461
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000204
Family I set domains 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW011695-PA
Sequence length 527
Comment cell adhesion molecule, putative|DS880792:13930:49179:-1|gene:ISCW011695
Sequence
PPLPELRHGHIKGYYVGYKLHNSSELHLYKTVEARDADPEAPGECVLNNLRKHTKYSVLV
QAYNAIGAGPRSDEAVVRTAQDVPQVAPPGVQCSSSSPTTIRVSWTKLLEKNLDGVHKGY
RVIYRQIRTQHAQYEGFTGEEENSWAERDVNAGSSAAVLSSLEPYSNYSVRVAARTGAGA
GAFSDPVHCSTPEAVPQAPEDIKALILAPDAILVSWKPPVRSRGVLLRYTVYSRSHGYRE
QAPCVFVSGLTTRDFRYIEPRAWPLVRRLLPNTAVVARFARGEDKGLATGNERRKKAQEK
SATEPQLLDTADFIIRHLEAAAAIGPGSAAPPAADVGPVRHVAVPSSQFWHETRGLRTGQ
RYEFWVTASTAAGEGPATRIVTQSPEIRGPGASLQNGWTAHADPGVEDRWRRPRKRRTGC
GCCLRAPLRIESAEQPDSANYSCHAHNVYGRDSVHYAVHVHSEFNLRLRVFTWVPGPTKR
YENDLRPSETGLGQRAVHFTQQHYPGLAQEELQRRIVHASGQSVVAL
Download sequence
Identical sequences B7Q859
XP_002412294.1.51680 6945.ISCW011695-PA ISCW011695-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]