SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW011704-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW011704-PA
Domain Number 1 Region: 176-278
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000253
Family MAM domain 0.015
Further Details:      
 
Weak hits

Sequence:  ISCW011704-PA
Domain Number - Region: 387-443
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000633
Family MAM domain 0.01
Further Details:      
 
Domain Number - Region: 282-386
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00237
Family MAM domain 0.035
Further Details:      
 
Domain Number - Region: 70-164
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.068
Family MAM domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW011704-PA
Sequence length 478
Comment hypothetical protein|DS877536:10861:70143:1|gene:ISCW011704
Sequence
MEFQYIVAGGKDAKLLVNSASLVKNIKDDKIQDVIWEAGGGEFDTWLLGRIALSDKTRKS
NMRYLSPFYVPPTGTFIFASGAMNAKNHNSMGLTSPKVPEQTQLVCATFRYHLFGALGTF
LKVSLMKENNDDEGRPRVARQTFILHKGRTTVDRWFTVQRNLNMNAEFNTAHREANGSTV
TSPWFQGRLEPQCLKFLYRRDKVNLGKIFVELAVSGAKESSVIWKQPPYPKDDWLLARVP
IVSQEKLKVVFRAIINASKDRSIDTFGIDDVQLDPEPCKPLYECDFAEDFCGYVNGFTFG
GLQWLVGTGRVAKPELPPRVPPYPSPSVEYSKSDPKSWERFAYVDLTVSTGALLSGAEKA
DLISPVFEVADKEDTLRLWYFRRGPDKCTFELGSPCGFYWEHSSPRIWRVVQSKALKVPD
HTLHDNAGHFLYVNTTVVDPAHPESRVFLDTRLPLPLHVRTRRHQAALFHQPDYASDH
Download sequence
Identical sequences B7Q7S6
ISCW011704-PA XP_002412206.1.51680 6945.ISCW011704-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]