SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW011914-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW011914-PA
Domain Number 1 Region: 280-405
Classification Level Classification E-value
Superfamily NHL repeat 1.52e-23
Family NHL repeat 0.0026
Further Details:      
 
Domain Number 2 Region: 174-229
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000229
Family B-box zinc-binding domain 0.0032
Further Details:      
 
Domain Number 3 Region: 26-76
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000209
Family RING finger domain, C3HC4 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW011914-PA
Sequence length 405
Comment conserved hypothetical protein|DS929843:38902:41248:1|gene:ISCW011914
Sequence
MQEVQREPRFSPVSAGFGASRGDLAGLSCSRCRGSRVNVSVLPCFHTFCPKCLDEVSDKG
DPLGHCKCPVCEDGLDSYAFSQSIIISNILNVVKEDYETGTAVPVAANPVLDYGPCSGCD
EHIRAAGRCRDCNEMLCENCVWAHQRVRLTKEHTIIHFEEESQGQQGAAHKAPAGPPTYC
CEKHDREVLRLYCETCSQALCRECTMKEHLGHSFVYLQDAVKAARTAAPATLADVRALAD
ALEEGVERSRLMSERLRLRTQSVAAETARSSTKYGFDGPLWKQFDSPRGVAFIGDGHMVV
TDFNNHRVLVIRPDFQSASYLGLEGKDPGLFQRPQGLAVDLEGHIVVADSRNHRVQVFRP
DGKLLAWFGQQGKERGQLELPSGICIAPDGRIVVVDFGNNRVQVF
Download sequence
Identical sequences B7QG92
XP_002401313.1.51680 6945.ISCW011914-PA ISCW011914-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]