SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW011983-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ISCW011983-PA
Domain Number - Region: 28-59
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0108
Family Growth factor receptor domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW011983-PA
Sequence length 60
Comment secreted protein, putative|DS924381:12958:14593:1|gene:ISCW011983
Sequence
MRVALLLLLVAAVSIIGVQSTSPPICTNVKCADQHCNPVSCTCGSYKGSCGCCDVCYKVS
Download sequence
Identical sequences B7QF67
6945.ISCW011983-PA XP_002414181.1.51680 ISCW011983-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]