SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW012040-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW012040-PA
Domain Number 1 Region: 187-549
Classification Level Classification E-value
Superfamily RNI-like 7.85e-44
Family Cyclin A/CDK2-associated p19, Skp2 0.072
Further Details:      
 
Domain Number 2 Region: 2-278
Classification Level Classification E-value
Superfamily L domain-like 1.02e-36
Family Ngr ectodomain-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW012040-PA
Sequence length 550
Comment adenylate cyclase, putative|DS921316:325509:327158:1|gene:ISCW012040
Sequence
DLTILDLSSNHIHTIVGLPFPESIIKLDLSGNLLDELPSECFSNLKTLTYLLLNDNQIKQ
LPAQWHLPTQHLDTLALNRNLLSTLSSKLFLDNRVTVHLLLLADNYIRHVPSSVFKLVTI
KHLSLSVNHLKTLPATLFDGLDGLLAHLDISHNFIVEFPKAIRPLRRLQLLNLEDNLLSH
FDEYDFFASRQHLQYLDLSANRLETVPKASIKFLSKLQTLRLADNVIQTITGDDFKHGLE
ELLLLDLTGNQIVSIEDEAFFMLKNLAELRLAFNPIKKLGNDILPKPCPKLNILRLSHTA
VDLYKAKGPLHSCYNISGIYALHSKITSLDTSVLCRSKNLQVLNLSHNNLQIVPRQCFKR
SAQGKLKTLVLAHNRVNVIESSAFSNLTSLETIDLSFNQLDSLASKVFRNLPNLIVLNLS
HNLISSIEPNCFQDLPKLRSLSVDFNRLISLDVSLVSTRSTFPVLQLCLSHNSISHLSST
IGDYHTLNVTRVDLSWNSIASIPRHFFWTMRHRLYLLNLSHNHLKTIHVEITSELPRVQI
LDLSHNLITE
Download sequence
Identical sequences B7QEK3
ISCW012040-PA 6945.ISCW012040-PA XP_002413967.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]