SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW012102-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW012102-PA
Domain Number 1 Region: 116-206
Classification Level Classification E-value
Superfamily Immunoglobulin 7.18e-16
Family I set domains 0.058
Further Details:      
 
Domain Number 2 Region: 202-288
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000305
Family Fibronectin type III 0.004
Further Details:      
 
Domain Number 3 Region: 2-106
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000103
Family I set domains 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW012102-PA
Sequence length 397
Comment sidestep protein, putative|DS929041:650:13759:-1|gene:ISCW012102
Sequence
PPEPPVIRDGAGNELRSTIGPYNEGSTLALVCVVYGGKPKPTLVWSGIPEGMMSEIRPSS
EAQLTTSTLLIHALRREDLRTTLDCAASNNISSPASTSVTLDLNLRPVAVKIRRGDIPIS
AGLPAEIVCEVWGSRPPPVVTWWKGLQQLNHTFVYVSTDGNVTTSVVSFTPASEDHGSNL
ACRAKNPAMVESVEEDTWSMDVQWPPGPVENCSITNQTEGSLHLECQAGSDGHLPAHFQL
SVHDAMTAALSANFTADRPDFWVHDLLPGVEYFLVVWAVNERGRSPELTILPPIMPLVGK
LTKSGNTVKISSNALLVTVVSAVALLCLLPVFVLAAVKLKNKRFFVKTRETKKEVVDEDA
CPSTTAASPEEATQLQISSIYPKEDNQLWIVKKSTGL
Download sequence
Identical sequences B7QG41
6945.ISCW012102-PA ISCW012102-PA XP_002401145.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]