SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW012219-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW012219-PA
Domain Number 1 Region: 82-233
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000142
Family MAM domain 0.0089
Further Details:      
 
Domain Number 2 Region: 238-418
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000015
Family MAM domain 0.012
Further Details:      
 
Domain Number 3 Region: 422-457
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000707
Family LDL receptor-like module 0.004
Further Details:      
 
Weak hits

Sequence:  ISCW012219-PA
Domain Number - Region: 457-577
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00823
Family MAM domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW012219-PA
Sequence length 685
Comment hypothetical protein|DS913803:50889:138923:-1|gene:ISCW012219
Sequence
MVAKNHGPLLLTSPKVPRQTQPVCATFRYHLFGALGTVMRVSLMNEDKAEEGHRRVVYQS
FIFHAGRTTVDRWFTVQRNLNMNAEFNTYDTCDWTLEGTSNGWRRNSNLLRGYNSHTRSG
PPDSNAFLELRAYKEGNGSTVTSPWFQGSLEPQCLKFWYKRDKPNLGKIVVELAVSGAKE
SSVIWEQPPYPQDDWMLARVPIVSQEKLKFTLEVHISSGLIALDDLEVTSGKCPLIDKCT
FELGSPCGFYWEHSSPRIWRVVQSKALKVPDHTLQNNAGHFLYVNTTDVDPAHPESRVFL
DTRDPTPSTCVTFWWKGFGTPSDLNPIQPKAIAGGKCSVQKTLPSSPKTTHCNLGTSTSG
CTIYAGDKVLRHPTKRWRLYFFNLSWGLKDGMTIRAFCGTDETAFVALDDIEVDQRECNL
PATDDFVCKTSPVEKIPVEKVCDFVKDCSNGADELDCGNCVFENSTCGWDLGSAESRDLA
SWQRRRAGVIPGAPKLTYDGDTNDDSFEMDLDLEVNGHDMTIWSLYSVTPKAREGTWNFA
EAVIGRYTGAVKLRFREFQYPANDGYFAIDGLQYDNCDLPRYRGLYDPSIVHRKRQSRAE
GTVPVYEESIKAQVAVYVHERIPHVQFDMCEWSTSDQEVVAARLALPNVKKRILVVSEYL
RGKVKWNFKYILQLKARYPNDYIVM
Download sequence
Identical sequences B7QDI0
ISCW012219-PA 6945.ISCW012219-PA XP_002413594.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]