SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW012492-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ISCW012492-PA
Domain Number - Region: 21-48
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00624
Family Fibronectin type III 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW012492-PA
Sequence length 68
Comment hypothetical protein|DS908400:1900:5661:-1|gene:ISCW012492
Sequence
MRDHGDSNPEIKSLRPTGEHVASVPDAPSVITLVGGNSTTAAVTWTFRDTETVDIQVGKL
VELKMKAS
Download sequence
Identical sequences B7QCL4
ISCW012492-PA 6945.ISCW012492-PA XP_002413278.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]