SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW012513-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW012513-PA
Domain Number 1 Region: 11-194
Classification Level Classification E-value
Superfamily Fibronectin type III 7.7e-31
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 2 Region: 169-252
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000349
Family Fibronectin type III 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW012513-PA
Sequence length 259
Comment cell adhesion molecule, putative|DS912050:47:5355:1|gene:ISCW012513
Sequence
MASMVSKIPEGAPTGLQHATVTGLENVVYWGQVPCDLANGVVSRYYLELDSADPWESELR
NQTTKDTRLGFSDLLPYTRYRARVYAENAAGRSRVAAELNFTTLPTAPPAPSNLMAYQLS
QTNVSLSWQPPYPPYGILDRYQVKFWTSDTRLQPSLLDIDTFRCSGGDLNRHCFTVPNLL
PVRLYHFSVRAFNKGTTHGPYSVELEEETRERVPDAPASVHGTDRAEDSLKIQWDEPLRK
NGYLKSYRVSFCDLVRREL
Download sequence
Identical sequences B7QDB6
XP_002413530.1.51680 6945.ISCW012513-PA ISCW012513-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]