SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW012545-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ISCW012545-PA
Domain Number - Region: 14-138,174-190
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0103
Family Growth factor receptor domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW012545-PA
Sequence length 221
Comment hypothetical protein|DS903676:85425:100071:1|gene:ISCW012545
Sequence
MPRSSPKERLKRLCKWRYIDDEQAAQCQQCVDEYPLPANFEYEDVSNLRNKCLPRPSRKE
LLRKTCDWYFRNQNIEKSACEACVEKSRLDENASYDDEAQVRSICMPRKPPRERVKDACP
RRFKDSEEIEKCRKCADNFMNDPANNEVQTVDVQQLYRRCLAGNNLKARLLQECQQKMPE
PDVANKCKACILRTYQWRVPKHMIREARKRCFIEGFQENES
Download sequence
Identical sequences B7QBW4
XP_002413028.1.51680 ISCW012545-PA 6945.ISCW012545-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]