SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW012572-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW012572-PA
Domain Number 1 Region: 372-632
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-54
Family YWTD domain 0.00000041
Further Details:      
 
Domain Number 2 Region: 286-365,632-680
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.35e-19
Family Growth factor receptor domain 0.023
Further Details:      
 
Domain Number 3 Region: 119-159
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000131
Family LDL receptor-like module 0.00072
Further Details:      
 
Domain Number 4 Region: 36-78
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000072
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 5 Region: 80-119
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000017
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 6 Region: 165-203
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000641
Family LDL receptor-like module 0.00056
Further Details:      
 
Domain Number 7 Region: 2-38
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000759
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 8 Region: 205-249
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 9 Region: 246-284
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000012
Family LDL receptor-like module 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW012572-PA
Sequence length 810
Comment vitellogenin receptor, putative|DS903676:459091:474168:-1|gene:ISCW012572
Sequence
KRTCSQTEFRCKNGNCIPSRWQCDNENDCEDKSDEDVVTCSNKTCSEEQFTCKSQECIPI
TWRCDGQEDCVDGSDEKDECLAATCTHEEFSCNNGKCITKRWVCDQDDDCGDGSDEKGCA
NVTCSSAEFMCSNGRCIPDRWHCDGDIDCLDGSDERNCPTTGRPSPCKVREFQCANGVDC
IHTSWQCDGDPDCPDESDEANCTNTCRPDQFQCRNLHCIPGLLECNGKVECPDRSDEDHC
NTTVNRCNPDTEFDCGGNHCIPKHLVCDGKNDCGAFEDEPRELCHKNECSTGHSGCSDIC
KDDPIGFHCECHPGFKLTEDNRTCDDVDECLIPGSCSQKCTNYKGGYKCECIEGYVPEPR
DRHRCKAKEGVPFLLFANRNDIRKINLETGEYVEVVSKLRSTIAMDYIYRTGTVIWSDTV
KEEISSAPIDTGAPTKVIINKDLHVADGLAVDWIYNHVYWTDTAQNLISVADLDGKNRKA
LFSEDLDEPRAIVVNPLEGWMFWTDWGRQPKIERSGMDGSHRSAIVTTDILWPNGLAIDF
VSKQLFWVDAKLHLIGSSDYNGNNRRVILSSPILVKHPFSLDVFEDWLYWTDWESEVINK
VNKFTGANLTGLANGVYSPMDIHVYHSYKQPQGTNHCKPTNGQCSHLCLPAPTISPHSAK
FSCACPNKMELQEDGHNCRIVGESPTAFHLEARSTPTVTDETVVYNASHNEVSAQPSVGH
RDLLGKLDTGKLAGIVIGVLGGLAIIFTLIGYVVYRQCLRRNITSMNFDNPVYRKTTEDQ
FSLEKNQYQPARSYPPSMEPLTSPGTNEFV
Download sequence
Identical sequences B7QBX8
6945.ISCW012572-PA XP_002413042.1.51680 ISCW012572-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]