SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW012620-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW012620-PA
Domain Number 1 Region: 43-223
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.25e-29
Family Laminin G-like module 0.0043
Further Details:      
 
Weak hits

Sequence:  ISCW012620-PA
Domain Number - Region: 217-244
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000158
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW012620-PA
Sequence length 570
Comment hypothetical protein|DS924515:424:10311:1|gene:ISCW012620
Sequence
MADVLFNDVDLFESAVSSEGVTWGDCAGEFSAVVDQAFSLVEADAFLALARPIARTGGSL
SLEVRTQAQFALVAYCAGPPSKEDFVALEIVQGHPIASLNQGNGVVTLRSETTVSDGAWH
RLGLHFGPSHVELSVDGQVQSLRTGLGRNQFFDLAGHLYLGGLDVASQSRAVLQHGLQSE
TSLRGCLRHGQVNDKPVGLPDALVTRGLKPDCVWEFPCLQDPCQPGARCVQDGTDGFRCL
CAPDGEEESESVADDCVRANFTGPYRVFASLDELLALAPLRVAEGGSDVVTTEHIKLLVD
YRELGVSDTGVLFHVMDPPKHGALEIEVWHRGTPDNVFTFADLETRKVRYTHDGSENHGD
SVVFELEFRSRSFDLPASLQRRRRFVLHVLVSPVNDAPRVKVPPGKVLRLAKGTRKLLTS
ELLEADDEDTKPSELVYKVLSLGDTDKDGFMEHADRPGEPLRSFTQANIDRRLVSFVHRG
REAESHVALGVSDGGSEAQSQTVVLRVQAFDLALSLANNTGLVLARGGWTALSTTNLSAV
TNAPDQSLDIRYEVSGSIERFQLATRQSPA
Download sequence
Identical sequences B7QF91
6945.ISCW012620-PA XP_002414205.1.51680 ISCW012620-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]