SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW012623-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW012623-PA
Domain Number 1 Region: 36-258
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.91e-74
Family Lectin leg-like 0.0000184
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW012623-PA
Sequence length 334
Comment lectin, putative|DS927877:6586:22133:-1|gene:ISCW012623
Sequence
MAPQEMLRRMMLLFLLGTICMVQNLLATAEWNTKDYMKKEHSLVKPYQGAGMTIPNWDFL
GNTMVTGQYIRLTPDRQSSKGAIWNNVPCKSKNWEMHVHFKVHGSGKELFGDGFAIWYAK
EALQLGPVFGSKDKFSGLAIFFDTYANQNGPHNHGHPYISAMVNNGTLSYDHDRDGTHTE
LAGCEAKFRNLDHDTHIAVRYENDVLTVSTDIEGKNAWKECFTVKGVQLPTNYYFGASAV
TGDLSDNHDIISMKLFEIDLPTEKQRDTEDRSKIVPSASYFAPPRDHIEDPPPAMSGTKL
FLIVLCAILGLVLCIIVGFIVFQKQQETSRKRFY
Download sequence
Identical sequences B7QFT9
ISCW012623-PA 6945.ISCW012623-PA XP_002400938.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]