SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW013040-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ISCW013040-PA
Domain Number - Region: 24-103
Classification Level Classification E-value
Superfamily NHL repeat 0.0288
Family NHL repeat 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW013040-PA
Sequence length 616
Comment conserved hypothetical protein|DS928991:178702:183495:1|gene:ISCW013040
Sequence
FAMADEKGYFLELSSNPIRFEPVSKITNVFFDDANQQVFAVRSGGATGVVVKGPDDSKST
DFSMDDKGDVISIKFSPDLKILAIQRSQKSVEFVNFSGSVDSRNEGMTFQKGEVPIVRDS
IIIFISFNICCVAFLKRFKVPTRSHTHHSSCFGGDQSGNFSLGNILHPFQFKPGIATRLP
KFEVDLPIIPKPPRVCLLERDVTAAVLYGKCAIVVLRHQARTSVGGAGAEIVVYTLQKEG
PPRKTDLLKLDTSGRFAVNVVDSLIIVHHQASKRSMLFDIRIPGISDGFVSHHRPVVPAS
PIKPFKLKVPMVPNNSLEEVSYELYSPNWVVFQPNIVIDAKIGCLWYVQLSLEPLLAHFD
DKRKLVDFLLQRSNSKEVLLGVCRRLLAKGSELPLEQLADVFDKLAAKEGCVEPSDMYAH
VFSEFADEAEDRHHFVVSTLVEYIRSLVEHRVAVPYCLNELLINVLVRNRRFHQLHQFLQ
YHVLTDTKPLACLLLSLHTLYPPATQLALDMLKRLGTANEEIVEVLLSQHKVLSAIRFVQ
NTGGTDAISARKFLEAARSHDDDTVFYAVFKFFEHRNVALRGKPEFAKGEHCEQYVKHFE
TLYGEPTATATTAAAT
Download sequence
Identical sequences B7QG37
6945.ISCW013040-PA XP_002401136.1.51680 ISCW013040-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]