SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW013154-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW013154-PA
Domain Number 1 Region: 1-295
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.41e-64
Family L-arabinose binding protein-like 0.000000315
Further Details:      
 
Weak hits

Sequence:  ISCW013154-PA
Domain Number - Region: 321-379
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00471
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW013154-PA
Sequence length 688
Comment metabotropic glutamate receptor 4, 6, 7, putative|DS908406:8172:49656:-1|gene:ISCW013154
Sequence
MVEIVKLLKWTYVSILYEESNYGLKAFNELEEQLKSENICIAIKEKLTKDSGVAAEDSYD
NIIRNLLSKQRARGVIVFGSDQEVAGVMRAVRRNNATGHFSWIGSDGWSARAVVFEDHEA
QVEGTLSVQPQARKVEGFDDYFLSLTVDNNRRNPWFTEFWEHFFKCKWPGSLVTPYNQDY
ARRCTGHERLSRSQGYEPERQLQFVGDAVLAFAYALRDMHRSLCGANYVGLCDRMDPVDG
TELLGFLQDVEFTGLSGETFRFSEHGDGPARYNILHFKQVRRGDYRWVPVGDYRDGSLRL
DMSQLQFRLDDPAMPRSVCSEPCPRGWATRLVEGESCCWHCLRCTDYQFLVSGGCAECAP
GTLPDPFHERCLPVPESHMSPGSPWAAAALALASLGALAALAVLAVFLAYRDTPVVRASG
RELSCVLLAGILLCHGTALLLVQRPSAAVCGAQRAALGLCFAVVYSAILAKTDRIARIFR
AGRRSAQRPGCISPRSQLALCGALVSVQGLVAALWLALRPPRAVHHHPTREDNQLVCLAS
VQRAGYALALAYPLCLVAVCTVYAVLTRKIPEAFNESKYIGFAMYTTCVIWLAFLPIYLT
TWRHVNLNLTSMAVAVSLSASVTLACLFVPKLYIILLHPEKNVRQSIMAKYGTLKNQQQH
RVESATQSDGACFLLPYWRASRRKFTPA
Download sequence
Identical sequences B7QCL5
XP_002413279.1.51680 6945.ISCW013154-PA ISCW013154-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]