SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW013202-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW013202-PA
Domain Number 1 Region: 5-62
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000103
Family Laminin G-like module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW013202-PA
Sequence length 71
Comment hypothetical protein|DS924890:4101:4316:-1|gene:ISCW013202
Sequence
MHVFGPKVDDREWHKVDLSVFRDHVVLYLDCEKHSSLELTTPRAPIDVNGDVNLAKFEAD
LSTVPVRHGPT
Download sequence
Identical sequences B7QFC7
ISCW013202-PA XP_002414241.1.51680 6945.ISCW013202-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]