SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW013229-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ISCW013229-PA
Domain Number - Region: 48-108
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0785
Family Growth factor receptor domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW013229-PA
Sequence length 112
Comment hypothetical protein|DS894052:21145:21483:1|gene:ISCW013229
Sequence
MRSQRELTMLSSGCLMTLLLLLAACRVDALPADATLLSSSVGDATGSPPAMTCACGSDVG
ACPAGRTAKTSRCPPCGLMCAKQTGESCSADEPCAKDFGLSCDAASGTCRGE
Download sequence
Identical sequences B7QAD7
ISCW013229-PA 6945.ISCW013229-PA XP_002400525.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]