SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW013231-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW013231-PA
Domain Number 1 Region: 85-147
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000647
Family Fibronectin type III 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW013231-PA
Sequence length 162
Comment hypothetical protein|DS894052:98152:112056:1|gene:ISCW013231
Sequence
MFPGANEAVLGGFYSAVVGRSSASAREERRWQGEASNLLDEFPSLLRGRFAVANADADAA
FCLAATTGQPLGVRQTSGKLLIERTGVTHNSATLQWKMRHYPTPYPGVFYTPRYAGSDTR
WTNAEPNESSVTLKNLRPSTEYVVRIMQDGTQEMVVVKTKGE
Download sequence
Identical sequences B7QAD9
XP_002400527.1.51680 6945.ISCW013231-PA ISCW013231-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]