SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW013418-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW013418-PA
Domain Number 1 Region: 37-230
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.1e-40
Family Laminin G-like module 0.0015
Further Details:      
 
Weak hits

Sequence:  ISCW013418-PA
Domain Number - Region: 8-32
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000224
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW013418-PA
Sequence length 270
Comment agrin, putative|DS912556:612855:626127:1|gene:ISCW013418
Sequence
MCRERGPKTDDFECICKAGYSGRRCEIEEDFCSKINPCQNGAECVGHGNSYRCNCPKGFS
GPNCESFVTFDENASFHGDGWVALSRDLLPHTADNSSEVIKLSFSTTERDGLLLFQGQPK
GVNARGQDYISLAVVNGLLEFSYEMGSGPAQIISKQRVDDGGLHTVELRRTGRQGVLKLD
DREVHGESPGMLIRLNTKSDIYIGGAPEPREMTANRNHEGFKGCIFNVQIQDSGIINLYK
DSNEAVNTDQCEQHFGSGDYLTNFEAMSNK
Download sequence
Identical sequences B7QDC7
XP_002413541.1.51680 ISCW013418-PA 6945.ISCW013418-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]