SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW013475-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW013475-PA
Domain Number 1 Region: 952-1174
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-40
Family YWTD domain 0.00000255
Further Details:      
 
Domain Number 2 Region: 436-575
Classification Level Classification E-value
Superfamily GFP-like 8.27e-24
Family Domain G2 of nidogen-1 0.001
Further Details:      
 
Domain Number 3 Region: 393-433,580-662
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000143
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 4 Region: 773-852,887-942,989-997
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000251
Family Growth factor receptor domain 0.011
Further Details:      
 
Weak hits

Sequence:  ISCW013475-PA
Domain Number - Region: 673-817
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000124
Family Growth factor receptor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW013475-PA
Sequence length 1192
Comment lipophorin receptor, putative|DS901018:6593:43969:1|gene:ISCW013475
Sequence
MREIFRQRCQKDALEARLCEHRGPLDRMPPAESHGQGVQQGGVVRRRLVALRPAPAHRLQ
TSGVHKTPQTRPRTHVLVFPPAGQVGNLNAGADGVEACVQYGHGEKRRGESGASSLMTAE
MEAPAVASDSGDPTDSRRQDEGGPDSGRVDKTVDVLPPWLRVRDRRPEPDQENDVSSAEV
QLSHPITFYGTEYSTLYVNDNGLVSFLTDVPSFFSAEFPLSYPLIAPLYCDVDTRGTGRV
FYRETQEESLLLRFTALVSSQYAAASFRARSLFVATWDAVGYYERKIDKVNTFQLVIGFD
ERDAYALLLYPEGGIQWIQADGKVPSLPDAKAQAGFMSGDKTRYTLLRGSGTDHVVNLDK
MGNTGVPGQWLFRISGQDGAEPDSAGRSGSDGGGGTCASVRVPCPPSSVCVDYEAGFCCR
CDRGSFGNGKNCIKDGGEFNRTAEVRFKQTGHQVTIHEHYLGVDVFNMMKVNVEIRGSLP
TISQGSKVTVDDYSQDFDHVSPGVVKAHLSNQFSLEGSSLPVEYTVDQTIVFSDCPHAPV
GKKGLQRVQVGRNFIDLDTKDGIVRYAQTTKVSPVDGDHPCQGIQCGAHSSCVADGTGHR
CQCNVGYETLHGRGQLPICVDVNECTSGQHNCHVHAECMNLEGSFACRCRPGYNGDGVNC
QGNPSPDQAPQCRCPAGFTGDGSSCVPSATDCRQSPLMCDVNAQCEYNARTRSYGCRCRS
GFRGDGVFCAEQSCLEADDCHPDAHCVYDRQVDAYFCACDPGFSGDGYVCYPQAEGDCSR
CAPTGGACVRDADGRPMCRCVEGYEGDGYVCRPLDECSTLENCDPHAQCLFDGRRYRCQC
NDGYSGDGKVCEPRHDASHTGTPCNLVNRCGASAQCLYDPVSRAHRCVCDPGTQGDGYRC
LPAASCFDDPSLCARNADCVRQPGGSPVCQCQPGFTGDGRACAPAPRDQGGYLLFGQGMS
ILQMPLAPTKGNPGKLLLMEQHQTVVGLASDCADGHIYWTDAASGTIRRAFSNGSSPETF
RSGLRSPEGIAVDWASRNIFWTDSLDDTVEVASLDGAYHHVIVHDGLVNPRGIAVHPALG
KVYWTDWDRSRPRIEACHMDGTGRSVLVEGDGLELPNMLALDLEHNDLCWTDAGRRTVEC
VNLSGGGRRTVYTPAQYPFGLALAAGKVFWTDWAXXXRLSKCRGGQTDTSVS
Download sequence
Identical sequences B7QBE5
ISCW013475-PA XP_002412871.1.51680 6945.ISCW013475-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]