SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW014027-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW014027-PA
Domain Number 1 Region: 851-968
Classification Level Classification E-value
Superfamily Fibronectin type III 2.28e-19
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 2 Region: 169-268
Classification Level Classification E-value
Superfamily Immunoglobulin 4.33e-18
Family I set domains 0.031
Further Details:      
 
Domain Number 3 Region: 61-169
Classification Level Classification E-value
Superfamily Immunoglobulin 2.8e-17
Family C1 set domains (antibody constant domain-like) 0.034
Further Details:      
 
Domain Number 4 Region: 464-567
Classification Level Classification E-value
Superfamily Immunoglobulin 1.69e-16
Family I set domains 0.022
Further Details:      
 
Domain Number 5 Region: 761-868
Classification Level Classification E-value
Superfamily Immunoglobulin 8.9e-16
Family I set domains 0.012
Further Details:      
 
Domain Number 6 Region: 675-764
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000235
Family I set domains 0.023
Further Details:      
 
Domain Number 7 Region: 368-465
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000271
Family I set domains 0.021
Further Details:      
 
Domain Number 8 Region: 563-666
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000137
Family I set domains 0.025
Further Details:      
 
Domain Number 9 Region: 268-368
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000185
Family I set domains 0.071
Further Details:      
 
Domain Number 10 Region: 8-64
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000103
Family I set domains 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW014027-PA
Sequence length 1084
Comment nephrin, putative|DS950968:62509:126900:-1|gene:ISCW014027
Sequence
FNRSIPGYPRYSMTGDPMQGIHNLKIENATLDDDAEYQCQVGPTSDHKAIRADAHVTVLL
PPASVTITDHPNGSSVEVRQSESVKLTCVVSQAKPAAQLKWYRKNVELRPDNVHYSVEES
EGGRQNAISSLTLTPHSDDNGVVYSCEAVHPALESPMATSVRLGVLFAPGPPEIHGYTEG
ETIRMGDTTTLRCISRGGNPLAQLVWYRNQEERSVDSSYTTSGRESVNTLTFVANSSDNN
AVYRCVATNVVSPEPVSAAVRLTVQFAPSKVKVRGPKEAKAGDQITMRCSTERSNPPAEV
SWVVDGRPFESVSTITADPKGGWVTTSNITVNITGQERNMKMFSCYAVNQALGDTVVETA
AVSILYAPDAPRIFGYTEGTPIRAKTLQHITCVTNGGNPLPTVRWFKGTQKVNSTTKTNG
NSVSAEVAIIAQDSDNGAVYRCEASNPATKKALTTSIKLTVHFPPTAVTIKIKPRKPKSG
QKMTLTCETGSSHPQSSISWWKDGLQLTGGVDDVVVDGPFGGRASKNVLVINVTADDDRA
NYMCQATNRALQLSVHDSVTLDVTYKPEFYNAPLERFDIVEGESLVINLTARANPSAVTY
SWTKDERRVATARATERSADRALPSVYARGSLLNLTNVERSHGGVYDCEAENSEGSTKTS
ILINIQYGAIVKAVTETVIVDAGSHAQLECEVDAKPFDEDTVSWRRQGFDMSRTRQLVKD
RRAYLTVHNVSRQDSGPFDCVAHNGIGEESVKTANLVVKFRPEIDRSPPHLKAAGQEGGT
AELLCRAQAAPNATFAWSREGSVITSSSRPDKYDVSVAQVDLVTFESTLSVKAIRSSDYG
HYECVARNELGFDSAKVHLDTLSAPDPPLQLQVTNATYNSLTLVWRPGFDGGLPQSFRLR
YRKAASNEGYHYQDVLLSNMTNYTIGGLGHDTEYTVGIMAFNEYGQGEYLKDIVKGKTTG
ECLPTVRPMGSLAVPTVIITSVSVVGTSLLFLNIVLVICFVRKRRKKRLEEEESDQSSKT
ATIEMYAPSSYNETMNGETVSSTSEKSEAYSNEHSAEYSVSEESSKPAAATYLIDQGSDT
YVPE
Download sequence
Identical sequences B7QJB1
XP_002415268.1.51680 6945.ISCW014027-PA ISCW014027-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]