SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW014794-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW014794-PA
Domain Number 1 Region: 74-256
Classification Level Classification E-value
Superfamily Fibronectin type III 3.65e-26
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 2 Region: 231-370
Classification Level Classification E-value
Superfamily Fibronectin type III 1.17e-18
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 3 Region: 396-534
Classification Level Classification E-value
Superfamily Fibronectin type III 2.6e-18
Family Fibronectin type III 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW014794-PA
Sequence length 542
Comment cell adhesion molecule, putative|DS943244:4394:54933:-1|gene:ISCW014794
Sequence
MRVNLEELRPYTAYIISVHAVTVEPGPELTTNFTTEQDGDTGLPKLSGSNATFPPKALVL
WDHVRDDGINVPEGTPTALNYSKGTGDEYVIFWGPVPCELANGVVRRYYMELDSADPWES
RLVNHTTGDMRLVFSDLLPYTRYRAKVYAENDAGRSKVAAELNFTTSPAAPNEVRQLQIT
RSFARQASFAWLPPATPNGRIRDYGVAYRPLRLVLPCSPIEQTETKLVVPMSSQRVNLED
LRPYTVYIISVHAVTVKPGPDFTSNFTTEQDVPEGTPTALNYSKGTGDEYVIFWGPVPCE
LANGVVRRYYLELDSADPWESRLLNHTTGDMRLVFSDLLPYTRYRAKVFAENDAGRSQVA
AELNFTTSPAVVYRPLRLVLPCSAIEQTETKLIVPMSSQRVNLEELRPYTVYIISVHAVT
VKPGPEFTTNFTTEQAVPEGTPTALNYSKGTGDEYVIFWGPVPCELANGVVRRYYLELDS
ADPWESRLLNHTTGDMRLVFSDLLPYTRYRAKVFAENDAGRSQVAAELNLTTLPAGTISV
ER
Download sequence
Identical sequences B7QI28
6945.ISCW014794-PA ISCW014794-PA XP_002414835.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]