SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW014795-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW014795-PA
Domain Number 1 Region: 18-147
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000121
Family Fibronectin type III 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW014795-PA
Sequence length 188
Comment hypothetical protein|DS943244:69959:83302:-1|gene:ISCW014795
Sequence
MKLNESWVKVVVVAVPKAPKYSRTLHGLRSGDAYEVRVLVIDSDGKFRETGSLTTTFRTL
CGRPTSPPTNVKIDNSSADSVLLTWENPPRESWLCWSANVTLEVNGTTESFNLTEPGVNA
TDRFVVPTRPFTDLTVRLRLDTPEGTSSQWTRLWTIRSAEDGQESRAHGTTGPTLSGRLV
HRGKALAT
Download sequence
Identical sequences B7QI29
XP_002414836.1.51680 ISCW014795-PA 6945.ISCW014795-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]