SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW014897-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ISCW014897-PA
Domain Number - Region: 10-26,57-76
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.1
Family Growth factor receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW014897-PA
Sequence length 120
Comment conserved hypothetical protein|DS951552:119:10602:-1|gene:ISCW014897
Sequence
MDSCEASQGLGFRRGSYRCRCKEGFYAPGVVQAPGDSGGAGEMVGEALEASGEAFHCLPC
PARCGNACQEEGQACFVQYNMAWRSLALGLQSFCTTVTLVLMVIVFRLRKSKTTNEYDQR
Download sequence
Identical sequences B7QJD6
6945.ISCW014897-PA ISCW014897-PA XP_002415293.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]