SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW014969-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ISCW014969-PA
Domain Number - Region: 15-43
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00463
Family Growth factor receptor domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW014969-PA
Sequence length 176
Comment conserved hypothetical protein|DS969302:197906:206518:1|gene:ISCW014969
Sequence
MLGQPCRRDEQCHKIDKHADCDDGYCKCEDGYYLFHDINGTSCLQDQELQTIRPFGADRK
SESISEENMVPIIVCLAIMFVGMCVALQLFSRARFRNQRTIFNTPNARLTPLKLGSGKRG
KRRASHVSLPGGSRRPSACSQLSPSRAGYVYAPTETNTNKGTERSACPCPFVFVFV
Download sequence
Identical sequences B7QM61
6945.ISCW014969-PA XP_002416266.1.51680 ISCW014969-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]