SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW015131-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW015131-PA
Domain Number 1 Region: 46-89
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000572
Family EGF-type module 0.0072
Further Details:      
 
Domain Number 2 Region: 148-288
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000111
Family Laminin G-like module 0.035
Further Details:      
 
Domain Number 3 Region: 85-136
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000718
Family EGF-type module 0.012
Further Details:      
 
Domain Number 4 Region: 7-52
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000133
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW015131-PA
Sequence length 302
Comment hypothetical protein|DS974589:379:19813:1|gene:ISCW015131
Sequence
ELCETDISVCNDTATCYNGGTCVEGPGDSFQCRCVAGFAGDFCQVDVDECFSSPCLNGGK
CQDHPGGFVCSCDFGWTGEVCEVRLQECDSNDCLNGGLCFVPTSAEGLSLSNASSECFCV
PDYHGTRCESRYDECIPGSPCHNGGTCIDGVDDYSCSCAVDFTDVSISEIYFKGDIRSHS
SYVELSVPIDTSDSIEFRLRFYTDNPLQTALLAFMGQEGTTILRSPDLLVASVDQHEVVF
GHHRRYGWLETDGQVKAVGLSKGPLNSLNVAPSLFVGGHPSVRFEGLPKLDVDLRSGFVE
PR
Download sequence
Identical sequences B7QN02
XP_002400469.1.51680 ISCW015131-PA 6945.ISCW015131-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]