SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW015833-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW015833-PA
Domain Number 1 Region: 116-153
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000315
Family EGF-type module 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW015833-PA
Sequence length 177
Comment conserved hypothetical protein|DS616883:54467:71240:1|gene:ISCW015833
Sequence
EEEDLCTEFFQKQLNKSNGMYVCQKVGDNYLFKCRDGLFSYNEVTSGRLTRWSCADKRED
IPLASSESPKLVTDKEPQPGTEGNVTKNTPVPDVTDKEPQTGTEGTVTKTTPVSDDPCSP
SPCVNGGVCKPGTGKTFTCECPKGFKGNLCEEKNSGVSVQAPVTAILGIAMSLLLLL
Download sequence
Identical sequences B7P1H0
XP_002433378.1.51680 6945.ISCW015833-PA ISCW015833-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]