SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW016099-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW016099-PA
Domain Number 1 Region: 495-700
Classification Level Classification E-value
Superfamily Fibronectin type III 4.85e-41
Family Fibronectin type III 0.00011
Further Details:      
 
Domain Number 2 Region: 701-849
Classification Level Classification E-value
Superfamily Fibronectin type III 3.26e-21
Family Fibronectin type III 0.0054
Further Details:      
 
Domain Number 3 Region: 79-174
Classification Level Classification E-value
Superfamily Immunoglobulin 2.22e-19
Family I set domains 0.015
Further Details:      
 
Domain Number 4 Region: 359-493
Classification Level Classification E-value
Superfamily Immunoglobulin 2.1e-18
Family I set domains 0.015
Further Details:      
 
Domain Number 5 Region: 180-270
Classification Level Classification E-value
Superfamily Immunoglobulin 8.11e-18
Family I set domains 0.013
Further Details:      
 
Domain Number 6 Region: 266-368
Classification Level Classification E-value
Superfamily Immunoglobulin 2.47e-17
Family I set domains 0.028
Further Details:      
 
Domain Number 7 Region: 2-76
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000168
Family I set domains 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW016099-PA
Sequence length 990
Comment hypothetical protein|DS615387:410007:495085:-1|gene:ISCW016099
Sequence
MSAKLNCTTTTGSVDLSEVTWYKDGRPLKTDVLRVRLETMANLVIRPVEKRDAGMYQCFV
GGNLELAQASAEIAVAETAPSLTQTFYQRSAKPGESISLQCQSKGRPLPTFSWERDQELL
LSDRRVRITSVHISNQVISVLNITRVYAEDSGLYGCRATNEAGSVAHWARVGVHGKVFVH
QGLSNVTAVPGQDVRIQCRYGGFPVDSVSWYKDDVLLPRNVRHSLDNDGNLRIRDFMGSV
DAGDYTCVVKSRDQEVRATTQLVLVVPPVIDDHFFPETITVDEGSRSRLLCSVSKGDGPL
RFQWFKDGQLLSSVPDGSVQYSDDSAMIKFRKVRFRDRGKYTCFATNDAAGDNRTTDVVV
NVSPRIKVAPQNSTTSVGGQVMLDCVAEGFPTPVVTWQKFEPPQFKERFKVLYVRRGETF
QAHCSTSSGDAPIAFTWEKNYRPLNCSRCVTRNNSDGSDLTLLGTIRSDSAVYACIARNG
VGEDVTFLQVVVQESPDAPWGLMLTNHSSRTASLLLHAPYDGNSDILKYKVQYKLEQGKY
GFGREIVVPAGETTATLTNLHPVSTYEIRVVAENAFGASAPSNVTVVTTKEEAPSGPPVS
VSLYTTGSQSLKVTWRPPSRDQHHGVILGYHVGYRVADGAEPGAPSVKQVDSRGANSSHG
LETTYLTNLRRLTKYAVTVQAYNGAGRGPSSEEVYATTLETEYVLHYGGDDGDWKSHQLA
AHERQFLLQNLRCGSQYRLYVTASNSLGMGEPGEEAVVRTRGSPPVAPSKEGLIVANKTS
ALLRLGRWGDGGCPVDRFVLQYRQKLEPAWAAVAQTVAPPPQGEHLLTGLAPGKVYELSV
VAHNDAGATRAEYDFVTLSPKATKTKTEPMSGSSGGFRFPLQENLVFIVPALLSALVVLL
VLVFLYFYWRKQAPVADTASEKELPGRKVYAEESFIISELPRKAERSSQDPQGVGGSIFD
PRAKRNYHIYTTNQSESTVLSLPAIKHSVP
Download sequence
Identical sequences B7P188
ISCW016099-PA 6945.ISCW016099-PA XP_002400622.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]