SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW016179-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW016179-PA
Domain Number 1 Region: 28-254
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.36e-75
Family Lectin leg-like 0.000000151
Further Details:      
 
Weak hits

Sequence:  ISCW016179-PA
Domain Number - Region: 264-303
Classification Level Classification E-value
Superfamily HMG-box 0.00814
Family HMG-box 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW016179-PA
Sequence length 496
Comment mannose-binding endoplasmic reticulum-golgi intermediate compartment lectin|DS626813:144052:159330:-1|gene:ISCW016179
Sequence
MAAAVMNCLRTALLGALVVQLYATQIGHRKFEYKYSFKGPYLAQKDGSVPFWEYGGNCIA
SEEMVRITPSLKSKKGSIWSKLPTSFPWWEVELVFRTTGTGRIGADGLAFWYTDKKQAEG
PVFGSSDKWTGLAIFFDSFDNDNKHNNPYIMGMVNDGTKAYDHESDGANQQLAGCQRDFR
NKPYPVRAKIEYFNNILTVLFHNGNTNNDGDYEMCFRAENVFLPTNGHFGVSAATGGLAD
DHDALKFLTTSLHAEGTQPALAQGMADSEKEKFSKEYEVYKDKLEKQKEEYRKTHPEEAA
KQAMEHGPDQAYDTQQQRELRQIFEGQSHMFEGLKALHRKLDEVLGRQERTLSLVSAGGA
GVAVGGVPPPQMGGVPSLQRHEAESLLSSQRELLQTVAQVKSFVAEVHQRTATLQHQGAG
GTQGLTAEQLQVLHQVRDSVASMHRDVSNNQPQRTGCATSCLSTTHFLLFATLQLAVTLG
YLVYRSSKEAAAKKFY
Download sequence
Identical sequences B7P364
ISCW016179-PA XP_002403623.1.51680 6945.ISCW016179-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]