SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW016330-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW016330-PA
Domain Number 1 Region: 87-141
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000419
Family Laminin-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW016330-PA
Sequence length 148
Comment netrin, putative|DS642248:1131843:1146882:1|gene:ISCW016330
Sequence
MNEALPTKPEETLRSCRARGSAVLLAIREVLRAVCVCWVRAGACSNTSVAVFSELNISVS
LADCFLRLFRPDTKKPVFVFLFFLPACNCNLHARRCRFNMELFKLSGRQSGGVCLNCRHN
TAGRHCHYCKEGYYRDHSKPITHRKACK
Download sequence
Identical sequences B7P5R9
6945.ISCW016330-PA ISCW016330-PA XP_002407809.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]