SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW016434-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW016434-PA
Domain Number 1 Region: 44-244
Classification Level Classification E-value
Superfamily Fibronectin type III 1.26e-43
Family Fibronectin type III 0.0004
Further Details:      
 
Domain Number 2 Region: 203-339
Classification Level Classification E-value
Superfamily Fibronectin type III 1.4e-25
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 3 Region: 5-51
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000269
Family I set domains 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW016434-PA
Sequence length 384
Comment cell adhesion molecule, putative|DS650268:96083:115887:1|gene:ISCW016434
Sequence
MTESGLRSELFISSTERSDGAVYTCRADNEFGRDERTSKLLVVEVPGQPQDVKVSETWTR
SASVTWSPPYSGNSPVAKYVIQFWKDSGAAHRLQEVAVPGSQTSALVGDLHPGSTYQLNI
LAENSVGVGQASTPVKLHTGEEEPSAPPTDFHVEARGPSTARVSWKPPPPDEWNGDLLGY
YIGYKPTSSGQPYSFRTSEFKPNTSHEFFLTGLQRGTEYSVVVKAYNAAGSGVASHELHV
KTLDGDVPPPPKVFVSGTSHSSITVTWHQQFPTGVRGFVLHYRAEDGLQDWKEVNVDART
SSYTVPRLESGVLYQLYVSTTNEYGMGDPSEIITVRTHKNGSEGPSFTVRGSREPPPFQP
SSAKKRQHGRGTMSVVGIRFVMPD
Download sequence
Identical sequences B7P782
XP_002409791.1.51680 ISCW016434-PA 6945.ISCW016434-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]