SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW016579-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW016579-PA
Domain Number 1 Region: 6-275
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.38e-53
Family L-arabinose binding protein-like 0.000000468
Further Details:      
 
Weak hits

Sequence:  ISCW016579-PA
Domain Number - Region: 292-349
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0733
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW016579-PA
Sequence length 942
Comment metabotropic glutamate receptor 1, putative|DS614359:190697:267345:-1|gene:ISCW016579
Sequence
MLEIGNYGYNGIDEFTSRAKDAGICVANSHAIPTDADDDDYDNVVRSLDKFAAARVVVCF
CEGFTVQALINATNRLRVAGKYVFFGSDGWSDRQDVVKNQEKASVGSLSIRFHANYDHDF
DRYYFGLDPFTNLRNPWFKEFWEVRFNCSLSIGPGSARYNRTCTGKEQLREGHKQDTKVE
FVKKSIYTMAHGLHNMHRDLCPNTSGVCPAMVPVNGSIFLQYLMNVTFDWGNETVFFHEN
GDPPGRYDLMNYQKLPGTQHFDYVQVGSWINGEMRMTGDVQWNRAQVNPPISICSLPCEK
GKVKSIHSETMKCCWNCVECKENQVVLDEYTCMDCERGWWPNENLTGCDRIPEEYIRWSD
SQSIAAMTIACLGFLATLAAMVIFIRHNDTPVVKSSTRELSYIILLRHDLLGPGHQDNRI
ARILAGSKKKIITKKPRFMSATAQVVITWLLISVEAAIIGAMVVLEPPDYMFAYPALDRV
KLICNTTTLGIIAPLGFDFFLIAMCTVYAVKTRNVPENFNEAKFIGFTMYTTLVIWAAFV
PIYFGSKHKVITLCLCISFSAEVALVLLFLPRVYIIIFRPDKNNRSAFTTSKDVRCHIGY
MNSAVTGPGGSSAAAAAAAATSAVSRNSSHSTSEFSLESPRNHSGDTVLKPPPTRSKSLN
LLERFRASKQDRIAASVAQHIRAVRAAEALDRRTRLRHSAEPLFGPNKIPATRTSSDSPP
GAQERKRLVGMLQHAYGADGQRLPQTAGAVGPRQEASCQTTDDLVEMWLPCLRRRIVRSE
TLMSTLTPEEDEDPGGALAPGLRHRKLCRHVPAAVGADDDVSDVVFRGGSSQGALPPPLR
YGRPGSERSAFKSDESLIEGASSIVEESASSGSEDAAVYKNIIISLGSPDTVRVRQTPAS
PVMVPRDVRDDTLPAPVTPSPWAEVSAQLLLRSYNDQEPFGK
Download sequence
Identical sequences B7P127
XP_002400087.1.51680 6945.ISCW016579-PA ISCW016579-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]