SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW016765-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW016765-PA
Domain Number 1 Region: 1842-1944
Classification Level Classification E-value
Superfamily Cadherin-like 2.88e-31
Family Cadherin 0.0008
Further Details:      
 
Domain Number 2 Region: 1203-1312
Classification Level Classification E-value
Superfamily Cadherin-like 2.62e-30
Family Cadherin 0.0014
Further Details:      
 
Domain Number 3 Region: 1945-2048
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-29
Family Cadherin 0.00093
Further Details:      
 
Domain Number 4 Region: 996-1099
Classification Level Classification E-value
Superfamily Cadherin-like 1.7e-27
Family Cadherin 0.0012
Further Details:      
 
Domain Number 5 Region: 2050-2161
Classification Level Classification E-value
Superfamily Cadherin-like 8.11e-26
Family Cadherin 0.001
Further Details:      
 
Domain Number 6 Region: 1529-1640
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-25
Family Cadherin 0.001
Further Details:      
 
Domain Number 7 Region: 788-895
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-23
Family Cadherin 0.0017
Further Details:      
 
Domain Number 8 Region: 476-597
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-23
Family Cadherin 0.00081
Further Details:      
 
Domain Number 9 Region: 1735-1840
Classification Level Classification E-value
Superfamily Cadherin-like 1.24e-21
Family Cadherin 0.0015
Further Details:      
 
Domain Number 10 Region: 1305-1412
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-21
Family Cadherin 0.002
Further Details:      
 
Domain Number 11 Region: 2154-2256
Classification Level Classification E-value
Superfamily Cadherin-like 5.71e-21
Family Cadherin 0.0018
Further Details:      
 
Domain Number 12 Region: 1100-1200
Classification Level Classification E-value
Superfamily Cadherin-like 7.28e-21
Family Cadherin 0.0014
Further Details:      
 
Domain Number 13 Region: 895-1002
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-20
Family Cadherin 0.0025
Further Details:      
 
Domain Number 14 Region: 24-139
Classification Level Classification E-value
Superfamily Cadherin-like 1.23e-18
Family Cadherin 0.0041
Further Details:      
 
Domain Number 15 Region: 1633-1732
Classification Level Classification E-value
Superfamily Cadherin-like 3.66e-18
Family Cadherin 0.0037
Further Details:      
 
Domain Number 16 Region: 380-482
Classification Level Classification E-value
Superfamily Cadherin-like 1.14e-17
Family Cadherin 0.0084
Further Details:      
 
Domain Number 17 Region: 234-314
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-16
Family Cadherin 0.001
Further Details:      
 
Domain Number 18 Region: 585-690
Classification Level Classification E-value
Superfamily Cadherin-like 8.14e-16
Family Cadherin 0.004
Further Details:      
 
Domain Number 19 Region: 139-240
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000171
Family Cadherin 0.0059
Further Details:      
 
Domain Number 20 Region: 696-800
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000714
Family Cadherin 0.0021
Further Details:      
 
Domain Number 21 Region: 325-403
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000121
Family Cadherin 0.0055
Further Details:      
 
Domain Number 22 Region: 1420-1527
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000126
Family Cadherin 0.0034
Further Details:      
 
Domain Number 23 Region: 2264-2353
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000576
Family Cadherin 0.01
Further Details:      
 
Domain Number 24 Region: 2557-2634
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000772
Family Laminin G-like module 0.029
Further Details:      
 
Weak hits

Sequence:  ISCW016765-PA
Domain Number - Region: 2-29
Classification Level Classification E-value
Superfamily Cadherin-like 0.00082
Family Cadherin 0.012
Further Details:      
 
Domain Number - Region: 2531-2572
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00138
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 2513-2535
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0629
Family EGF-type module 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW016765-PA
Sequence length 2933
Comment protocadherin fat, putative|DS660824:3743:121092:1|gene:ISCW016765
Sequence
MYVYWVTVSDGGSPPLSSTTQVIVTVTDVNDNRPWFLESSHRFKVLEMEDKLEPVQLCQV
LATDLDEGVNRELRYSIVEGDGQMFHMDPATGTIYTRSALVNRVSHELLVKVSDRGEPPL
YATSKVLLNVVSRPENSLHPPQIQEVEVFPTIESDKVGHVVATVRAGDSDGDLVWYNIVD
GNQEGKFMIDKIGVIKLASPLDWETTQNYNLSVEVTDGVDKVTTQVLVSIVDANDQWPEF
TKSTFRVEISENIPPGTDVLQLSTTDSDGGRRLFYSLYNRQSVKKFQVDSLTGVLSTREA
LDHEEARRHLLTVVHAPTPAGNVGGSFSIHPQLGAITVARELSQQALPEYFLSVRATDHG
EPPLNSTTTVHVVVTVASNAPPRFTPSRRGVELFENEPSGTFVATLTMVSQTSLYFEIAD
GNDGDSFRVDPTSGVVFTNRVLDYEGCRFYNLTVVATNMVGANASAHVAVHVLDRNDNAP
RFLRDRYRGLVSEAAEVGSVVLAAQGDAPLVVTAEDADSEANALLVFEIVEKWARKFFHV
DTSTGALSIVHKLDREARAQYSFQVQVWDSGKPRLCARRPATILVNVTDVNDSPPVFEHQ
YYNASLLLPTYQGVRVARVRASDPDLESPFGVRYTLVAGDHEGHFEVLQDTGEVLVRNPE
GLQDLYRLVVSANDGQSETATFVIVTVAHSGNGNVRFARDSYEAFISENATEARVVTVVS
VLGTSLNEHVSFRILNPSDMFEIGPTSGVVRTVGRPFDRELVSAYRLVVEARSEADGPHN
AAHTVLDVGVLDVNDNAPIFVNLPYYSVVPVEAKAGDLVRKVEANDLDLGENGRVRYQLR
EGNSELFHVNAVSGEITLRQPLGTHNTEYTLVVAAVDNGIPSLETEAVVPIKVVNRAMPV
FPRQFYSVSVPENLPPDVPVITVQADSPKGRQLIYSIVSGNTNEEFAVDFNAGVVYVVEQ
LDYETHQKYQLTLRATDSVTGAFSDVLVGITVEDVNDFPPMFSQPSYNTSVSEATPYTTS
ILKVHASDRDTGANARVQYSLEASALSTFHIDPVEGVIDLRVPLDHEAQPLYHLVVTATD
AGSPSALSSTAHVWVTVLDMNDNPPAFPQLSYSCAVSELAPRGQFVMRVAASDPDSSDRD
RLAYSIVGGNEAQAFAIDRKTGIVTLSNLHQFPQQPTYLLNVSVTDGVYLSHAKVKVVVL
PSNRHSPAFTHTVYEAALPENRDAGFPVATVTATDKDRGHFGHVTYAIRSDDCATHFRID
NATGEIFTTKPLDRESRHLYLIPVSATDGGGRLAFTMVRVTVTDVNDNEPQFAVSEYRVN
IQVNTTVGTTILKVRAFDKDKGMAATLQYSIHDSGSLSNITSLFNVTHDSGEVYLKAPLE
GKENNAYQFFVRVRDHGTPKPLENVVPVTVVVMHPGELGPRVDLATSHYFLRESDPVGTV
VLTLNASQPHEHHGDPSSHQLTYTFVPAPAGSDHELDASTFSLDERGRMILVGELDRERQ
AEYYLAIRAETELSLVATVDVTVLVNDENDNAPMFDSASYRASVAENAEEGCAVAKLTAH
DADRLQKITYEFYEGNDPAADIFRVDAITGTVTTLVALDREAVPSYNFTVSARDDGLPPR
SATTWVFVEVVDVNDNAPAFARPRYDAAILEDAVPGTVIVTLETSDPDGVGAGLDLYVVS
GDPEERFGVRSTGEVFVGRPLDREATASYFLEVVATDGVFVATTQLAIDVLDANDNPPVC
LKSKYTELVSESIAVNTYILTVEATDADENRNAQLRYYLSGKGSDDFFINSTTGESRVLR
TSRLLDRERQPRFRLTAHVQDWGQWDWECTSAVEILLSDVNDNAPAFGQDAYTATVAEDV
DVGTLVAKVHATDRDLGFNRRVSYSFVDSARGHFSIDETSGIVMLNRPLDREERATFNLT
VQASDHGTPQLSSLATLLVVVQDVNDNPPEFSRKFYHAVVSEASAVGVEVLKVLATSRDS
GLNAEVTYFFSAGNELGHFSIDAKTGSVKVAKPLDYEDVRDYFLTVLARDGGLPALSNQA
SVNVSVTDYNDCPPVFGLPVYNAVVREDARVGDRIIQVIASDADSAANAALQYAVVRGDR
HGQFAIDKETGYISVAASLDREMISNYVLEVECTDGGTPPLSSKVLVNIEASDVNDNPPH
FAQANYSAIVQEGKPVGFTVLKFTVSDPDSSPNGAPFALEIISGNEDGTFRLVQTDSTLR
TASKLDPKLRSEYELVVRASDSGAPPLSSECRVFVKAIEDSQFPPEASPMAVSVTSYLDD
FPGGVLGRVRATDRDPYDQLAFELASSHQHLFSVDREDGTLIALPGLDVGTYSVNVSVSD
GKFTTYVGVSVEVVLVSEEGLLNAVGLTLADVTPEDFLLTYKKGFLKGLRSLLNVRLKEI
QVISIQPSAEEGGGSQPAQRSRRSAGQDLDVLFAVRKGAHGYYSAKFLKTRLKENLPLVE
AASGLFVRQVAEDRCTSTQCVHGECLDHMALDRTFAVSVTTDQFSFVSPQHSRRLDCQCK
PGFGGPKCEMAVNECSRKPCPPERLCVPDSSSLGYSCQCPEGKTGPGCTLVITCQDPDCY
EEKHPMSFGGKSYAHYSLVAPMDRRLTLALMLRTVQATGNIVYSAGARDYSILENGRLPA
GVGATGCVWRLELRGPDNTLRLRQVKVLGHGVGGGPDPEPRGDCRSLRIQQRNCEAETLR
VFRLLTSQVFGKLLGGEGEEEEAAQPRQSAAEEAVSPERPETSNDLKEHMVGILFSRSKL
THLQKQGKLTEPWARVTKGAIAENILNFTKIDEKYRTPTECLKTPTDHAANACSKTHLCG
HLCNGIRGEASCLPCLHGCGTARGLRQDADDMCMICFSEALSCAPAIQGYEQLLQISEDD
EEEPAQGASPHRYERRPNQYLFSHCLSNNQSPADDLSEDGVGDRSLVGLAVFH
Download sequence
Identical sequences B7P8W6
XP_002403288.1.51680 ISCW016765-PA 6945.ISCW016765-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]