SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW016850-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW016850-PA
Domain Number 1 Region: 42-133
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000348
Family Calnexin/calreticulin 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW016850-PA
Sequence length 138
Comment POGO family transposase, putative|DS672165:866782:867312:1|gene:ISCW016850
Sequence
MYFDLVLPLLVLGVLCDGEEAKEPKIEPVEDNNVMTLAELAHIAENFDDLDAFKDRWVLS
EATKDAAADSVAKYDGNWQVEAAALNHLRGDVVRGVVSGGPTAAYVKLLPDMEENGDLRR
FHKFHYTIMFVSDQRGTD
Download sequence
Identical sequences B7PAN0
XP_002407029.1.51680 ISCW016850-PA 6945.ISCW016850-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]