SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW016916-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW016916-PA
Domain Number 1 Region: 521-704
Classification Level Classification E-value
Superfamily Fibronectin type III 4.2e-31
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 2 Region: 288-382
Classification Level Classification E-value
Superfamily Immunoglobulin 3.79e-23
Family I set domains 0.015
Further Details:      
 
Domain Number 3 Region: 95-182
Classification Level Classification E-value
Superfamily Immunoglobulin 2.23e-22
Family I set domains 0.0078
Further Details:      
 
Domain Number 4 Region: 5-98
Classification Level Classification E-value
Superfamily Immunoglobulin 4.97e-22
Family I set domains 0.017
Further Details:      
 
Domain Number 5 Region: 395-497
Classification Level Classification E-value
Superfamily Fibronectin type III 4.61e-21
Family Fibronectin type III 0.00017
Further Details:      
 
Domain Number 6 Region: 187-282
Classification Level Classification E-value
Superfamily Immunoglobulin 1.22e-18
Family I set domains 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW016916-PA
Sequence length 705
Comment conserved hypothetical protein|DS679709:154660:171829:1|gene:ISCW016916
Sequence
LRDEFRVTPKSSRVAAGDSATLECVPPRGHPEPSVTWFKDGTQVATGTGRIRLLGHGSLL
IADVRHADQGRYVCRAANLLGTRETPAATLSVHTKPYFVRVPEDVTTLADDSVEFQCKVN
GDPKPTVTWRRQDGKMPVGRAFIQEDKSLRIQSVSPMDEGTYICESENFVGSVSASASLT
VHCKCQPRPSFRLTPEDQKVGLNGVAKFDCFATGNPQPSVFWTREGDQVLMFPGKSHGRF
LVTNQGTLVISSVRKEDRGYYTCSALSIVGSSMAKGYLEVTAIADLPPPVIRLGPANQTL
PINTAAIMPCEATGKPTPTVSWLYNAAPLQADTRPRFVILQSGTLRINGLQISDSGTYTC
TASSESGETSWTASLTVESPHNPNVNFHRTPDPSTFPGPPSKPVVVNISETSITLTWRRS
EKVGDSSLRGYTIEYYSSDLQSGWVSGAHRVLSETYTIQALRPDSRYVFIVRAENAHGLG
PPSPASDTIRTLGLAPHFLPEYNLDEARAKLTSCVVTLQEIRATSSTAVKLTWRVQGDKD
YVEGFYIRFRDVSGGSQKFNMVTVLNGGASSYVLNDLRAYAKYEFFLVPFYKSVEGPPSN
SRNVQTLEDVPTAAPEDVRAHVINFTTARIIWSPPPPQHCNGKLRGYNIYVTGNLSEPFL
NKSTNTTTNSLLLTNLKAGASYKVRIVAHTSVGSGPLSSPVLFRM
Download sequence
Identical sequences B7PBV8
XP_002408970.1.51680 ISCW016916-PA 6945.ISCW016916-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]