SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW016933-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW016933-PA
Domain Number 1 Region: 589-800
Classification Level Classification E-value
Superfamily Fibronectin type III 2.54e-38
Family Fibronectin type III 0.0027
Further Details:      
 
Domain Number 2 Region: 391-583
Classification Level Classification E-value
Superfamily Fibronectin type III 1.04e-31
Family Fibronectin type III 0.00026
Further Details:      
 
Domain Number 3 Region: 802-978
Classification Level Classification E-value
Superfamily Fibronectin type III 6.16e-26
Family Fibronectin type III 0.0045
Further Details:      
 
Domain Number 4 Region: 286-401
Classification Level Classification E-value
Superfamily Fibronectin type III 2.8e-17
Family Fibronectin type III 0.00053
Further Details:      
 
Weak hits

Sequence:  ISCW016933-PA
Domain Number - Region: 237-304
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0705
Family Fibronectin type III 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW016933-PA
Sequence length 1062
Comment factor for adipocyte differentiation, putative|DS689861:192845:241048:-1|gene:ISCW016933
Sequence
MVSNSTTPPMAVPVQVPPGHVVQQIVDENGTLRHIILSPQPQHVTLPTVATPYTGAPGGA
PPPAQPAAAFFPYTAPTPGAPAGLQFAGQFHSAMQAPLGASPHSPQGHAVPGVVPQQQPP
QGVVPPPHKDERSQKQALKLRKKLESRQGPSSSSLGAPSSGARSDSSSPKSDIALRALLS
SLSAPAVSQVGAREATAEWSAPVANAAPAPKEGEVAAAADGASSTAASSAAATPAAPPPA
PSLEEVSYELLLSEKGQDRPARLLKCGKVLRSKLEDLKPATEYILCPWSSTCRLTTCGAA
PVPPEPPVVGQVTASSAALEWDCRATDDSFTLSLEQEGSQHGFIPVYNGSETRFTCQRLI
RNTEYRVRLVAHNEEGSSGPSRVTSLRTLPDRPGRPARPSAKGRIRSHNFTASWEPPKDD
GGSEITRYSLQMDSGNGFEEVYAGPDRDHVCSGLEPGATYRLRVNCSSAGGVSDFSEVSS
VATLPLCPGACDPPRMHGKARAISTHIKWAPPAYDGGSPVTEFELQVAAAPDPESEARKE
PRVAYRGPDWDCTVAGLLPGRPYLYSVRAFNSAGAGPWSEPLHALSGSGPPDAPRGLSVQ
ARSASCALVSWEEATCHGAPVSEYLLECRQPETAASGATTFAQLYSGRTAHFEAKGLEPA
SCYCFRVQAVSSAGPSPFSDAVEFVTPPGVPGPVGSLECVRGHTSLELTWAQPPCHGSDI
THYVVEVTEMGPLSSSSASAASPAATSTSFSPASTHVAETTRLSVSSLRPETAYKVRVQA
VNGVGSGPLSSPALRTSTRALPPPAPSLECLGATHSSLRLRWGDQAEKSLRDFVQYTLEM
EVKPGLFAVLYQGPSHSYKASRLQENHPYRFRIQATSDAGEGPHSEPATFSTTRALPPAP
KAPRVTPQGDTSCLLEWQAVRLLTDDPVSYLVQLQQSGSSEFSVVYRDYDTRCSLSNLSP
HTFHCARVAAVRHCPQSPEPLCGPYGPATSFQLFAEPAAGNGGSSQVGASASATSGWSLQ
GSRSGLLPSLGDQQWAGILVGGFTLLAVLAAVLLQEVVARNQ
Download sequence
Identical sequences B7PDG7
6945.ISCW016933-PA XP_002410801.1.51680 ISCW016933-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]