SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW016942-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ISCW016942-PA
Domain Number - Region: 43-118
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0173
Family Growth factor receptor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW016942-PA
Sequence length 176
Comment hypothetical protein|DS689861:458839:459369:-1|gene:ISCW016942
Sequence
MLLGGLLGVIVLTNFQRASGKAAARSIPKSRKTTYDLLKSEPCNTDQTCSLRDPESRCLE
QFCVCQPGFTDVSGDRCKKLVQLGDVCTENHVCAGDAIQCVDERCICERGFNENEGACLK
TDPARATSKLVLYIVGVATLIFIVGGVSSMLYTQIRQRHIKDQACDNCFLVQCTIL
Download sequence
Identical sequences B7PDH6
ISCW016942-PA XP_002410810.1.51680 6945.ISCW016942-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]