SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW017033-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW017033-PA
Domain Number 1 Region: 2-358
Classification Level Classification E-value
Superfamily L domain-like 1.87e-63
Family Internalin LRR domain 0.04
Further Details:      
 
Domain Number 2 Region: 502-598
Classification Level Classification E-value
Superfamily Immunoglobulin 2.82e-22
Family I set domains 0.0067
Further Details:      
 
Domain Number 3 Region: 589-684
Classification Level Classification E-value
Superfamily Immunoglobulin 2.66e-20
Family I set domains 0.013
Further Details:      
 
Domain Number 4 Region: 394-445
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000391
Family V set domains (antibody variable domain-like) 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW017033-PA
Sequence length 732
Comment leucine-rich transmembrane protein, putative|DS664300:142419:160014:1|gene:ISCW017033
Sequence
KISHNHLIEIPDLGNLQHLGELHLAHNEIQSLGQNLLKYPSLRSLDLSFNKITVIPMGVF
TNSSRLLQLSLNSNKVSSVEKGSLDNLTSLETLRLNKNHLVTIPKDLFLKLQALKQLELN
KNRIRAIEGLSFKGLESLESLSLRRNSISHLSDGAFYYLGKIQNLNLDFNNITVVTKGWL
YGLSALKLLNLTGNSITEVGMDGWEYCRKLTHLDLTSNKLQAITTSTFAKAESLRFLYLG
HNMVSYIEEGAFKHLNHLKTLHLDHNEISWTMEDTNGPFLGLSSLVQLTLSDNSIKSLTP
RAFAGLGRLQSLDLSGNPVATIHQSTFAPLRRRLTNLKLDSGSLLCDCNLRWLPAWIVSM
GFQGKVQVRCGHPLPLQGRLVLDVGSENFTCDDFPKPQILESPETQIALKGQNITLVCRA
ATASSSTLEFQWRKEQKVSLYSLFFCLLMGNIFFSKALISRNILKQPLSSSCELQGLVTT
KCDHDDGEIRAVLCPSAHPVFPMFVRTPTNVTVRAGGTARLECGAVGQPTPTVAWQKDGG
DDFPAARERRMHVMPTDDVFFVVGLKAADSGVYTCTAHNPAGMVRASATLTVLEAPAFVR
PMKSKQVHAGDSALLECMSSGSPRPKLSWLKDGEPLVPTERHFFAADAQLLVIMESRPSD
SGQYACEMANTLGVERGLSVLRVLPAKSPLGPIGSDTDGMTTGIVVIVVVLCIVGTSLVW
VLIIYKTRKRQR
Download sequence
Identical sequences B7P9J1
6945.ISCW017033-PA XP_002404531.1.51680 ISCW017033-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]