SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW017057-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW017057-PA
Domain Number 1 Region: 688-817
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.48e-19
Family SPRY domain 0.019
Further Details:      
 
Domain Number 2 Region: 1133-1231
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000305
Family SPRY domain 0.02
Further Details:      
 
Weak hits

Sequence:  ISCW017057-PA
Domain Number - Region: 64-161
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00183
Family IP3 receptor type 1 binding core, domain 2 0.013
Further Details:      
 
Domain Number - Region: 140-226
Classification Level Classification E-value
Superfamily ARM repeat 0.023
Family HspBP1 domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW017057-PA
Sequence length 1822
Comment ryanodine receptor, putative|DS668850:109200:340214:-1|gene:ISCW017057
Sequence
MSEEGKMDDGLEFSRAQVEESRTARVIRKCGSLFNKFIVNLDAMQNEGATEESAISTIDQ
DEMIMCFEDLINYFVQPEDDIEHEEKQNKLKALRNRQDLFQEEGILNLILETIDKINTIT
TSGYLMTAGGEDAGQNWDAISGFLYQLLAAIIKGNHTNCAQFAQPHRLDWLFSRLSSQQA
SEGTGMLDVLHCVLIDSPEALNIMKEDHIKVIISLLEKHGRDPKVLDVLCSLCVTGKGVA
VRSSQNNICDNLLPGRNLLLQTRLVDHHAAQHIRGAGGGGGPVPALVLRGHGGPLRAAEP
PGAAPAHRVGQHGGLRALPGGRLQVGRQRPRGRPLLLRLRRGLPLDRCRCAGAAGGPAKW
SGGTSVYPSTHSRKLRIFTRRATFSTRSCRTPNVRACRFLLGGDQGKLRYGPPDGHSALV
EALLPQQVLTVEPCFQFGDVPKGVLFGPAAISDDAVFVPAPVDTSAIALPNYIESVRDKL
AENIHEVWSMKKIDAGWRYAEVRDDNRNVHPCLTSFEHLPPAEKKYDTTLALQTLKTILA
LGYHITVDKPPARIKTIKLPNDPYLQSNGYKPAPLDVGAISLTPKMEELVDLLSENTHNV
WAQERIQHGWTYGLVEASPTRRSPHLVPYKTVDDIIKKANRDTASELVRTLLAYGYVLEP
PTADSLEGAQSKVSSVKYDQRTYRAERTYAVTDGKWYFEFEVLTLGVMKVGWAGPNFLPS
CELGGDDNSWAFDGFKAAKNHAGGSEVYGKQWQIGDVIGCMLDLHDRTISFSLNGELLLD
SLGGETAFSDIPCGEGASYVPACTFGIGQKARLVFGHDVNLLRYFTTCGLQEGYQPFCVN
MNRNMTFWYNKDEAVFVNVDDAFHPNVEVSRIPAGGECPPALKIIHKLFESVEKVNYEFL
RLSLPVTCHDTLIEEIEKEQRWEEIRRRQRRAQAERKSIRHPGEMVFLRQQQHMLRSGFS
MSDVKGVPDGSGSRLRAASSEEALTRIGQPHKGQRSKATTPEPEGKAKRRGKSPFRFFRS
KKDEKEEKEPAPAQPAPAAPKAPTPATLAPPMLTVRAPSVQRLTPAGSQLLCPPVPDRPS
GLGGGGIPRTGSSRRPSLAPAPPPADDTGDRLDPSVLDLVDEYFYGLRVSRADPSHVYCG
WVTTRTVHDGAQHAKVRSLERQNCYMVCAGQLATEISHGEAGSRSANQGMYVGCHIDLAT
GMLTFSADGHITRHRFKMEPGTKLYPAAFFEATSKEVLQFELGHTPTTLPLSAALLHNTS
RHLTPQLPPRLKVQCVQPYVWARVPNVSLRPHALRLSEVRGWSMLCEDPVSMLALHIPEE
DRCIDILELIEHERLLNFHAHTLSLYGALCFQGNHRAAHMICSHVDEKQLMYAIQAEYLS
GPLRTGFTDLLISLHLEFHAYARSLTQNEFIVPLGPDIRELYQDPLKAHSFTTLECISIR
PEMSFSETREQVDSIADLSTPYFPVDALKQFVIEALADAVKKDSRPNRDPIGGSNENLFV
PLLKLADKLLLVGLLDDEDLQWLLYLLDPETFDPNYRNAGNGGALGLIDMQVAEGVKLQI
CYILHHLCDLQMRHRVEAIVSFSDDYVGNLQTDQLRRYIEIKQSDLPSSVAAKKTREFRC
SPKEQMRAILGFKHLEEENWDQCPCGEGLREVLSSMHADQLSRLKVATAAEEEAPEKEAD
GDRSLRQRLMHLVSLVRASEEESGGGEERVTLPEARPSLRGSTPLDVAYSSLMENSELAL
ALREHYLEKIAAYMSRCGLQSNLELIDRGYPDVGWDPVEGERYLDFLRFCVWVNGAFVGD
APVWAYLVARSRRTTLTWERPS
Download sequence
Identical sequences B7PA36
ISCW017057-PA XP_002406144.1.51680 6945.ISCW017057-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]