SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW017078-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW017078-PA
Domain Number 1 Region: 1034-1178
Classification Level Classification E-value
Superfamily Fibronectin type III 1.45e-24
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 2 Region: 556-651
Classification Level Classification E-value
Superfamily Immunoglobulin 6.55e-23
Family I set domains 0.0085
Further Details:      
 
Domain Number 3 Region: 754-911
Classification Level Classification E-value
Superfamily Fibronectin type III 6.54e-20
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 4 Region: 1-133
Classification Level Classification E-value
Superfamily C-type lectin-like 3.88e-18
Family C-type lectin domain 0.0043
Further Details:      
 
Domain Number 5 Region: 652-759
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000289
Family I set domains 0.024
Further Details:      
 
Domain Number 6 Region: 384-459
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000112
Family I set domains 0.011
Further Details:      
 
Domain Number 7 Region: 162-261
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000138
Family I set domains 0.014
Further Details:      
 
Domain Number 8 Region: 287-349
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000129
Family I set domains 0.0036
Further Details:      
 
Domain Number 9 Region: 490-552
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000199
Family I set domains 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW017078-PA
Sequence length 1185
Comment Contactin-5, putative|DS654280:420595:447594:1|gene:ISCW017078
Sequence
CPKGWDDYGTSCYKFNRSPTRTRDGAKEACQAYNCELVSVNTFEEHRFVVEWLREHDPQH
RRWFTSGFESGENVWTWEGDNTQFSNIDSLWLPQQDGYLWKYVSYNFSTELNRWGLQKVA
PGDELAFICEIPKERLFQIYIQERPIDFGYIITNREEVPRGPYFTEEPEEVIFDLSGRSQ
MNEISLRCVASGYPPPVYKWFKEEYYDDKLLNIYIDPLSNGRYTQTDGTLVIHDPDQAKD
RGKYHCTAENKYGRVLSRSVSLGFGYIGEFNKNRAGDSGKEYWGKSIACDPPQFNPSVHY
FWVRNSFPEFVEEDNRVFVSHDGNLYFSSLEKIDNANYSCNVQSKISSTGRTGPYFRVTV
DPASSGQKLLFPNNFPKSFPEAPLAGNEVRLECVAYGYPVPKYNWTRRGGPMPRGARIES
RGRVLLLPRIRVEDMGEYVCSASTGQDAIHKAVTLSVQATAKIDISPMSPGTLQSSAIRW
TNMHTRLAYWSYSWPPKNWLLLSLNVTFCHCCQVDNNIFIIEELVRKEDEGMYQCCATNT
LGSTYSSAQLRIVTMAPNFEKYPLESETYAAEEGNVTIACRPEAAPFPEFTWRRDGYAVP
TGGRLQVLNNGFLRIHPVRREDEGNYTCTAKNQYGTATSGGRLIVLPPPRSLEAPPPRLQ
AHVGGTEELMCQAIAPHMLDLSYIWLHNDLRLHPQDWPQYGVVSFFWIRTNLLALGPGYL
VIYNVTFAEAGRYTCIAKTSVGKVLANTELLVIGPPGPPGAVLGSNFNATSGFIEWADGT
NHGRPITSYAIEGRTNHNGTWRELINITYAAERRMTPGRRGVELGPVLSPWSKYEFRVIA
GNDLGVGQPSDPSPQYNTALDAPYVAPRNVGGGGGKAGSLTITWERLSPEEWNSPEIWYQ
VYYRPKGDRSEPRKKNLRNLGNVGLYVVPVGEENYYFPYEVGGDGLHRRPECRILSPSTR
NNCYNISFKFHFVLCLFFAPTTSQSLGNNVQAVRSQISRKQPKCSCFRFAVPQIKYWKSD
SNPELDSLVLLKRGIENWGLIVGLQPNTEYRVAVMAYNDAGSGPESEFFVAKTFKAAPLR
PPTSVKVRAHSDTSVKVTWRGVLPSIEEESIQACPGTWLGYKVRYWEADQDLTSAKEVYN
ALDGEDLEAIVTGLVPGKVYKLRVLAWSYGGDGKMSSPPWEFRVG
Download sequence
Identical sequences A0A1S4LP63 B7P7Y5
ISCW017078-PA 6945.ISCW017078-PA XP_002400195.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]