SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW017399-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ISCW017399-PA
Domain Number - Region: 129-178
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0014
Family Fibronectin type III 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW017399-PA
Sequence length 188
Comment tripartite motif protein trim9, putative|DS656406:229120:236267:1|gene:ISCW017399
Sequence
MTAQENCSVFESQISSQCDLLAEALECRRRELLAFARRERDAKLKALKAQLSNCTVTLQR
TTALLQFCIEALKETDHAAFLQIGSALVNRVANVDVTWHKDMAPTPWASPDFDLTLDQRS
VLDAVNQLTFTQLKPPGAPQLIPEDSTAENNCVTVAWQPRVGSFVQGYVLELDDGNAGPF
RVSRACLS
Download sequence
Identical sequences B7P889
ISCW017399-PA XP_002401598.1.51680 6945.ISCW017399-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]