SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW017400-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW017400-PA
Domain Number 1 Region: 7-177
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.18e-39
Family SPRY domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW017400-PA
Sequence length 215
Comment tripartite motif protein trim9, putative|DS656406:269018:271687:1|gene:ISCW017400
Sequence
MTRCLSVAWFALDPGSCHPDVVLSDENVTARCESYEHRVVLGSLGFSRGVHYWEATVDRC
DNDADVVLGVARGDVAKDVMLGKDDKGWSMYIDHQRSWFLHADRHEHRVDGGVERGAVLG
VLLDLERRQLSFYVNDERQGPCVVLGPPIQGPGAALFPAFSLNRNVQLTVHTALDPPASS
SDDSDDDVNEPAPKTMTAANSPSVEIDLPLPPPMV
Download sequence
Identical sequences B7P890
ISCW017400-PA XP_002401599.1.51680 6945.ISCW017400-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]