SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW017407-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW017407-PA
Domain Number 1 Region: 237-336
Classification Level Classification E-value
Superfamily Immunoglobulin 2.37e-18
Family I set domains 0.039
Further Details:      
 
Domain Number 2 Region: 52-144
Classification Level Classification E-value
Superfamily Immunoglobulin 7.57e-18
Family I set domains 0.016
Further Details:      
 
Domain Number 3 Region: 338-439
Classification Level Classification E-value
Superfamily Immunoglobulin 5.84e-16
Family I set domains 0.0068
Further Details:      
 
Domain Number 4 Region: 136-236
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000256
Family I set domains 0.015
Further Details:      
 
Domain Number 5 Region: 423-478
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000159
Family Fibronectin type III 0.0034
Further Details:      
 
Domain Number 6 Region: 10-53
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000092
Family I set domains 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW017407-PA
Sequence length 485
Comment neural cell adhesion molecule L1, putative|DS682990:268361:305688:-1|gene:ISCW017407
Sequence
MGDYVTSDGSVVSFVNISAVRAEDGGLYRCSAGNDVGVSEHAARVNIHGPPFVRRMGNLS
VVAGEVLSITCPVGGHPIDSITWEREGLRLPYNHRQKAFPNGTLLVQDVERATDEGLYSC
TARNKDGLSAQNSVSVRVLVRPAIVPFSFPESLHQGQRFNVLCTVSKGDSPIHIAWYKDD
APVATTGAAAVSVLNVTQFSSTLIFDKLVPEHRGNYTCEARNQAGLVRATSTMVIHVPPR
WRIEPSDSIVVKGGTAIIDCQADGFPVPRVRWTKSEGNEPGDYRAISSSSRIHVFENGSL
AVHNSDEKDAGFFLCQASNGISPVLSKVVKLSVHVAAHFKSKFKAESVQRGHLVKLKCEA
FGDKPVIITWTRDKQPFDPKEDPRYELNETLLSGGIVSEITIRGADRRDSALFTCLARNS
YGTDDTNMQLILQEPPDSPPGVKLLEYGSRHVKLSWVTPYSGNSPVVKYVLQYREDSGKY
GKTSN
Download sequence
Identical sequences B7PCC0
XP_002409638.1.51680 ISCW017407-PA 6945.ISCW017407-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]