SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW017727-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ISCW017727-PA
Domain Number - Region: 11-54
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000237
Family Laminin G-like module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW017727-PA
Sequence length 66
Comment hypothetical protein|DS694917:14103:14974:-1|gene:ISCW017727
Sequence
MVYLCTVVFEQVVPITFVSSEAMLKVGGYMQRVMNCSFDFRTFNEQGLLLYNKFSVEGYV
KVTRVS
Download sequence
Identical sequences B7PEC4
XP_002433546.1.51680 ISCW017727-PA 6945.ISCW017727-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]