SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW017792-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW017792-PA
Domain Number 1 Region: 2719-2978
Classification Level Classification E-value
Superfamily YWTD domain 1.27e-50
Family YWTD domain 0.00000264
Further Details:      
 
Domain Number 2 Region: 1214-1474
Classification Level Classification E-value
Superfamily YWTD domain 3.4e-47
Family YWTD domain 0.00000327
Further Details:      
 
Domain Number 3 Region: 3569-3839
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-43
Family YWTD domain 0.0000186
Further Details:      
 
Domain Number 4 Region: 501-735
Classification Level Classification E-value
Superfamily YWTD domain 5.89e-39
Family YWTD domain 0.0000192
Further Details:      
 
Domain Number 5 Region: 1545-1797
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-38
Family YWTD domain 0.0000896
Further Details:      
 
Domain Number 6 Region: 1852-2100
Classification Level Classification E-value
Superfamily YWTD domain 1.15e-33
Family YWTD domain 0.0000458
Further Details:      
 
Domain Number 7 Region: 167-396
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-32
Family YWTD domain 0.0000623
Further Details:      
 
Domain Number 8 Region: 1132-1206,1464-1522
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.34e-18
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 9 Region: 3-39
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000055
Family LDL receptor-like module 0.00072
Further Details:      
 
Domain Number 10 Region: 837-878
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000055
Family LDL receptor-like module 0.00066
Further Details:      
 
Domain Number 11 Region: 2366-2407
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000602
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 12 Region: 2240-2282
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000825
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 13 Region: 956-998
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000288
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 14 Region: 3273-3311
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000471
Family LDL receptor-like module 0.0008
Further Details:      
 
Domain Number 15 Region: 2543-2583
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000537
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 16 Region: 3313-3350
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000942
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 17 Region: 1042-1081
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000102
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 18 Region: 921-958
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 19 Region: 876-915
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 20 Region: 3442-3479
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 21 Region: 2591-2626
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000353
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 22 Region: 3103-3142
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000419
Family LDL receptor-like module 0.00066
Further Details:      
 
Domain Number 23 Region: 3060-3101
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000511
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 24 Region: 3023-3062
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000537
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 25 Region: 2204-2242
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000903
Family LDL receptor-like module 0.00074
Further Details:      
 
Domain Number 26 Region: 802-837
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 27 Region: 3399-3434
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 28 Region: 84-157,423-471
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000157
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 29 Region: 3231-3269
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 30 Region: 2638-2678
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000041
Family EGF-type module 0.025
Further Details:      
 
Domain Number 31 Region: 2414-2448
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000445
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 32 Region: 2664-2711
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000573
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 33 Region: 3147-3184
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000602
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 34 Region: 2329-2367
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000681
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 35 Region: 2509-2543
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000105
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 36 Region: 3519-3560
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000124
Family EGF-type module 0.011
Further Details:      
 
Domain Number 37 Region: 1005-1040
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000406
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 38 Region: 3357-3394
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000432
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 39 Region: 2285-2324
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000103
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 40 Region: 41-77
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000118
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 41 Region: 3184-3225
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000393
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 42 Region: 3890-3928
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000406
Family EGF-type module 0.034
Further Details:      
 
Domain Number 43 Region: 1089-1124
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000537
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 44 Region: 2458-2499
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000576
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 45 Region: 2982-3022
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000124
Family EGF-type module 0.0053
Further Details:      
 
Weak hits

Sequence:  ISCW017792-PA
Domain Number - Region: 3844-3875
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00195
Family EGF-type module 0.01
Further Details:      
 
Domain Number - Region: 3488-3533
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00387
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 746-792
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00791
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW017792-PA
Sequence length 4124
Comment low density lipid receptor-related protein, putative|DS723986:89670:171217:-1|gene:ISCW017792
Sequence
FAPCNEGQFRCTNAICIPIRWRCDGHSDCSDQSDERNCTSVTCLDTKFLCPSEKKCIDKS
KLCDGKQDCDDGADEKKNCSSNLCRTLSCEYGCRASLDGGDCFCAPGMTINTKDKRTCVD
LNECSEWGYCDQLCTNSPGSFQCLCVRGYTLDPPRHCKADNSSSMRLLFTRHNAIYSVSA
DGADLSILANASSASGLDYHYERNTVYWTDTETKQVRAKPMLAASRPPISVVFTWNPVSM
AVDWVGNKLYVCDTLGQKIDLLEMDGLRHAIVLSRNLSNPQDIALDPTVGYMFFSDGDHI
DRAHMDGSHRSTVVTAIYKATGLTVDYVTKFLVWCDSQLDQIVAVDYTGSNRNIIIRGST
RVPSPNKITLFEDKVYWTDGTRQGVLKAKIFNNNDTVNIVHRDRQLSKEPGAIKSYHVLR
QPIVANPCGVSNGGCQHMCIVTRGSGGFGLLGYRCVCHTGFELAPNGKDCSRVSTFLLYS
QQKFVRGSLMNITHEGFTDAMVPIVSKSARFVGLDFDARDNFIYYSDVILDVIYRVTIDG
SGKENVLASQNEGVEGLALDWVSHNLYYIDSRKGTLNVISVKNFQYRRTLLKNLKRPRAI
VVHPNKGYVFYSEWDRPANISRAYLDGTNVMVFRGVLLGWPNGLSIDFQTDRLYWCDALL
DHIQHANLDGTDVQTINSPRIKHPFSLVIHGDWLFVTDWRLDAILMMHKTTGADEKIVTT
VEEGSRLYGIKVYSRENQKVDSRHPCQFNNGGCQKLCFPVPSNGSQGPDLVVSCGCPYGE
QLSKDNRTCVSDPTAEPPVQACPNTWDFTCDNQRCIPKTWVCDGDDDCLDNSDEMNNCTR
NTCSPREFQCSSGRCIPLSFKCDSDNDCGDFSDETGCTNVKCDNSEFSCENGRCIPQSWK
CDSENDCGDGSDEGDFCKEKTCAYYQFTCPGSGHCIPRSWVCDGDNDCFDQADENNCPPA
VCSASQFQCANKKQCIHESYRCDGVSDCQDGSDEQGCPSLAPDQCDQEKSFQCKKSRVCI
PKLWFCDGNADCEDASDEPSSCGQVECPQNHFKCNNSKCIFKSWICDGEDDCGDNSDEDN
RHACGAPKFQCEHGKWLCPGVTERCVNISSICDGKSDCPNGADEGPGCASTPCKENKAGC
THDCHVTPMGPLCVCPKGEVLNDSTTCVDLNECNIAGSCSQHCTNSKGSFTCACEDGYQL
ELKHKCKATNRSEAFLVISNRRSILVANLDTSFLERVPVKVENVVATASDMASNTIYWSD
MSVKKVFRLTKGGDPQVVISSGLDLVEGLAVDWVARNLYWVDSRLKTIEVSTLDGRNHIV
LLKENISQPRGLSLDPREGVRLMFWTDWGENPRVESVGLDGTMRKTIVHTKIYWPNGLTL
DLPNKRIYFADSKLDYIDFCNYDGSGRQQVLAHNHYLLHPHSLTIFEDTLYWTDRQLNRV
LSCQKFRGTNQTVVSHLVSQPLGIHVNHPVLQPQSSNPCSSAPCSHLCLLSPSRPSQYSC
RCPPGYTQDRASAGGSCIPVDTPFLMLMKANQLIDMSLSPDEKSAGQIVPVIGIENGYDF
DYDKQEGIIYWVQLSEDDKENGTIYTVSLKGGNVTKFLVDSIIGAPYALAFDWVGRNLYI
GNRKASNIEIVKVDGERKFRRILLTNDGSEKGVGKPKAMVVDPEQGKLFWLDEGGIGVPR
KLARVSMDGKNPIILVKENLRRLEALTIDLTGKRIYWSQSFEGIIESVDLDGNGRKTLVP
STLGLAKPQGLTVFSNKLYYLDSVHEKIARVDLPDGGNQVVLEDNTPGLVTLKVYGKKPG
RCLPLGLLQPLSETLHVWSNCPVPPEQFAIVISYFRIILITPQCIYLEDHGEAMQPIAGP
GHNILHLDVHVAMNHIYWIEFNQGERNGIYRIKPDGTDLKRVIADGIGSNGIRGVAVDWV
AGKKNPIKIIYFTNVFPHETYMEVCELDGSNRVILLKTTTDSPREIAVNPIKRYLYWIDY
GQYPKIEKAYLDGTNRVPIVVTGISNPRDLTIDIVTHDVYWVDSREDAVQKVAFSGGSRQ
YVRKNLPNPMGVAVSGQYVYWADRNLRTIYRASKFPSNTSTPAEPVKSDLNMLRDIVVFD
SSNQPPASSPCSTRPCDQLCFAMPEAFNSTKWKCGCASGELAPDGRKCDISKVFLVFTTR
REIRSLFMDPHKTNVPFQPRGNLTNVVGLDFDYADKRMYFTPENVSCDDTKFACGNGKCI
PRLWACDGDDDCGDNTDEDKSFCAQHTCGPTEFRCGNGRCIFKTWKCDHENDCGDSTDEE
DCEYPPCPDGEFTCANFRCIPKTQLCNGVNDCKDNKTSDESHANCPNNRTCPGNHLKCET
TNICVEPYWLCDGDNDCGDNSDEVAFLCSQRTCPPNSFRCPNHRCIPATWHCDGDDDCGD
GADEPEDYCKSEKRTCFGDLFTCDNGNCVPRIYICDGDNDCLDNSDEDVRHQCDTRECDP
EREFKCTQNKQWGRATCIPKRWVCDGDPDCVDGADENSTVHNCPAPEPCDVEKQYQCNNQ
RCINKDWVCDHDNDCGDGSDEPRNCTFRNCSSEEFTCRNAKCIRKSYHCDGEDDCGDGSD
ELEKDCKKEETTCSGAQFACKNGQCIPYERVCNKQQDCSDGSDEPTHCNVDECAKVEMNQ
CEHKCVNTLTSFYCECNEGYELLKDGKACADRNECRVKPSVCSQYCINTPGSYFCKCSQT
YYDRELDGHTCKRKDDVTPWLIFSNRYYLRNTSLDGTQYNLVKMNLRNVVAIDFDIREQR
IYFADVGNKTIQRIFTNGTGEQVLVRHDVHGLEGLAVDWIGRKMYWLDRTSKQMYVAELD
GTSRKTVLPKGISDPRAIAVHPGIGYLFFTDWGHHAFIGRMGLDGSNFTRIVLYENKLVW
PNALTIDYFSDKLFWADAHLDYIEFSDLDGSNRHTVLQGRSVPHVFALSVFDDWLFWTDW
NMKGVYRAHKFTGEKLQVLRNTSHRPYDIHVYHPLRQLDYPNPCGKTNGGCSHLCLISPG
AASFQCTCPDNFILLPDNKTCIANCTEGQFRCGGTDDRCISVFWKCDGDKDCRDGSDEVG
CPPFACKKGQFQCHNNSTCVPRVKICDGHNDCNDKSDEKFCGYPCGEHNFKCRNTGRCVP
VSWQCDGDNDCTDGSDEDPAICHHQECNTDTQYKCNNGKCIPKLWYCDFDDDCGDNSDEP
AHKCRNRNCTTGWQKCPSVTNYRCIPTWLFCDGKDDCRDNSDETSPEYCPKCHETGDFKC
RNNRCIPLRWRCDFEDDCGDNSDEDGTMCAELYRDCSESEFQCANKKCIPSRWRCDHDND
CEDGSDEKDCLNYECKENQFKCTSGHCILKRLVCDGNKDCHDVSDELNCPTRFPGGLYCQ
DMFQCNNTVCIRPDFMCDGDDDCGDFSDEADSICKDHKCDVTRKFQCQNNKCIPLWQLCN
GNDDCGDGSDENNHQLCGKLAPLPCLATEFKCTNGKCVPRMDVCNHEDDCGDLSDERGCH
EGTCDATSRGNCEHNCTTLGDANGYICTCANGYKIKEDDPKRCEDINECATFGHNCSQIC
ENLMGDYGCRCRDGYEMFKSHCHAKGPAPIILYTNGPDVRMLDMKNEIQSSVITGESRVQ
SLDFDPRENVLYWTDSYEKTIKRAFLPNLTDVSSGIGFPQNLELKGLNKPNAIAVDWVGR
TIYWMDTDLSNTRPKGRILVSLIDGRYRRTLLSTNLERPTSMAVDPEMGWMFWSDAGSNP
KIETAWMDGSKRRIIVGDKVGYPTGLTIDYASDHRVYWCDSKLNTIETSKQDGSNRVVLA
SGELLHPFAMDLFEDSIFWVTRDSGEIFRQDKHGRGVKVRVKRNVENPTGVKIFQPLKYN
LTVLNRCPSSACSHLCLLVPQGYRCACPDGTSLHVVNFGSCDAGFEVPKPQPYKCPCRNG
GHCESVRDDQIVCRCPSEFEGMHCENFIARRRISSLSGASGVAAVLVPIIVVIIIMIVAA
TLFVCVRRRHFKQSGLGGSTQSVSFRSGTNVEFSPNFMRNRPAETNGEPLDAEFGLNDVN
KPTDFSNPMYDALGNTETPVATGEPAKGGLYEVPGDVFDKKYDKNCFEPASNKAVNVGSA
VLHPSMVLHRSSPHVPLRQTALDPTTVDTDKDTQNLVEEDKSEC
Download sequence
Identical sequences B7PJ49
XP_002407037.1.51680 6945.ISCW017792-PA ISCW017792-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]