SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW017865-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW017865-PA
Domain Number 1 Region: 87-163
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000128
Family Rhodopsin-like 0.0093
Further Details:      
 
Weak hits

Sequence:  ISCW017865-PA
Domain Number - Region: 56-97
Classification Level Classification E-value
Superfamily Kelch motif 0.0183
Family Kelch motif 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW017865-PA
Sequence length 170
Comment hypothetical protein|DS711613:287447:289213:1|gene:ISCW017865
Sequence
MNLFLAAYPASSETGANSRGKPPVEASAMQSSYLNNCSLAGLVNAPSWLCGPDSSEYLYP
SGGNDSADYPCNLAEGCDPTTSSWDPTSSPEPYTESSYSQLLVSSRFWIQRVLVPIITII
GVVGNSVTIVIMTRRRMRSSTNNYLAALAIVDMMYLLGVFALSLKHDEFI
Download sequence
Identical sequences B7PH87
XP_002402353.1.51680 ISCW017865-PA 6945.ISCW017865-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]