SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW018183-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW018183-PA
Domain Number 1 Region: 12-102
Classification Level Classification E-value
Superfamily Immunoglobulin 5.75e-16
Family I set domains 0.021
Further Details:      
 
Domain Number 2 Region: 98-183
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000396
Family I set domains 0.041
Further Details:      
 
Weak hits

Sequence:  ISCW018183-PA
Domain Number - Region: 197-286
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000176
Family Fibronectin type III 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW018183-PA
Sequence length 326
Comment conserved hypothetical protein|DS692880:8540:31426:1|gene:ISCW018183
Sequence
PPRVTLQLGKGLREPVIEEGRDLYFECVVRANPAASLVQWFHNGASLEPAANGTSGLLST
GRYLVVRHVRATQAGTYSCSAHNALATTESNSVLLTVQYIPRCQKIWSSTSSNGTETTVS
CQVASVPEDVSFAWTVRDGSQGERVVDDADVWVNGSLSALTVSHASHGVVGDVTLYCRAR
NLLGLQRSPCVMAVDTRQKPGVLRDCSVSNQSDDRLLVSCSHADPHPGDRFLLEVQTAAK
LSFSVTRETPSFWIPSLEPGVESLLLLYVVNDRGGRGEPLKLTVHTDPYTAPLASADKRP
SSALGTSALLGLVMASLSAMLLAPTR
Download sequence
Identical sequences B7PDZ4
ISCW018183-PA 6945.ISCW018183-PA XP_002399572.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]