SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW018267-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW018267-PA
Domain Number 1 Region: 72-171
Classification Level Classification E-value
Superfamily Immunoglobulin 5.54e-18
Family C1 set domains (antibody constant domain-like) 0.024
Further Details:      
 
Domain Number 2 Region: 169-259
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000658
Family I set domains 0.016
Further Details:      
 
Domain Number 3 Region: 333-440
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000341
Family Fibronectin type III 0.0036
Further Details:      
 
Domain Number 4 Region: 230-347
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000145
Family V set domains (antibody variable domain-like) 0.091
Further Details:      
 
Weak hits

Sequence:  ISCW018267-PA
Domain Number - Region: 3-72
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000368
Family I set domains 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW018267-PA
Sequence length 459
Comment sidestep protein, putative|DS729868:55977:111913:-1|gene:ISCW018267
Sequence
MGDPPPQVTWSKDGNVIDDTFTVTPQGFVRNELRLGPLRRPDLMAQLVCTASNNNATLPL
SSRVSLDINLKPTEVKIGVPRQPAAAGDRVELRCLATGARPFAQVTWFKGGQRLTQVEDF
VSTATNSTVSSVSFIVAAEDNGRNVTCRADNPHLPKSEVSDTVVLNVHYAPQLTLTTVNR
RPLEGDNVTLVCAVNANPAASAVSWRHGGRVLDVRNDSLLLSRVGRRQAGSYECIASNVI
GEGFSNKLHLSVLYAPVCVEGLTREYAASADIRVLVACEVNASPGDVHFEWVANTTLRTG
RISSFTANGTKSYASTVTGTELEYGILLCFASNNVGKQIEPCTFRIVPPGPPGSPENCTV
VNLSPDSVLLKCSAGSSGGLQPVFQAEVFSVHADLLHNNISSSRQPHFKLSGLHKDTSFV
ALVYAANAKGRSSPVTVRFATGLLNSFPSATGVFVREIL
Download sequence
Identical sequences B7PK10
6945.ISCW018267-PA ISCW018267-PA XP_002409095.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]